SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9RD22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9RD22
Domain Number 1 Region: 73-142
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.0000000000234
Family Barwin 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9RD22
Sequence length 146
Comment (tr|K9RD22|K9RD22_9CYAN) Probable endolytic peptidoglycan transglycosylase RlpA {ECO:0000256|HAMAP-Rule:MF_02071} KW=Complete proteome; Reference proteome OX=373994 OS=Rivularia sp. PCC 7116. GN=Riv7116_2866 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Rivularia.
Sequence
MNQKRILLAFLGTVLGICFTASSFSQQAAFAYSESEESNVVERVENNQSLLIARRRKRRR
KARKCSSQIASYYGSNTKLTAAHKTLPFGTRVKVTNKRNGRSVIVRINDRGPFIRCRVID
VSRKAARELGMIRSGVAPVTLKVLGK
Download sequence
Identical sequences K9RD22
WP_015118932.1.44015 gi|427736366|ref|YP_007055910.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]