SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9RGG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9RGG2
Domain Number 1 Region: 5-73
Classification Level Classification E-value
Superfamily YggU-like 9.81e-24
Family YggU-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9RGG2
Sequence length 74
Comment (tr|K9RGG2|K9RGG2_9CYAN) UPF0235 protein Riv7116_3954 {ECO:0000256|HAMAP-Rule:MF_00634} KW=Complete proteome; Reference proteome OX=373994 OS=Rivularia sp. PCC 7116. GN=Riv7116_3954 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Rivularia.
Sequence
MQKIVKVKPNSKKQEIIEEDDGSLTIRLKSPPVDGKANEELIKILSKKFNVPKSYIRIKS
GASSRQKLIEIDTD
Download sequence
Identical sequences K9RGG2
WP_015119959.1.44015 gi|427737397|ref|YP_007056941.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]