SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9RGW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9RGW8
Domain Number 1 Region: 1-187
Classification Level Classification E-value
Superfamily ITPase-like 1.36e-62
Family ITPase (Ham1) 0.0000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9RGW8
Sequence length 190
Comment (tr|K9RGW8|K9RGW8_9CYAN) Nucleoside-triphosphate pyrophosphatase {ECO:0000256|HAMAP-Rule:MF_01405} KW=Complete proteome; Reference proteome OX=373994 OS=Rivularia sp. PCC 7116. GN=Riv7116_3875 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Rivularia.
Sequence
MKLVVATSNPGKLKELQKYLADLNWDLVLKPQELEVEETGDTFEENARLKASEVAIATNS
WAIADDSGLQVDALNGAPGVYSARYGANDSGRIARLLTELGNETNRGAQFACAIALARPD
GTIALESEGVCRGEILYKTRGDGGFGYDPIFYVPHLQLTFAQMNSELKRSVSHRGKAMEG
LLPQIEKLIV
Download sequence
Identical sequences K9RGW8
WP_015119883.1.44015 gi|427737320|ref|YP_007056864.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]