SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9RND4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9RND4
Domain Number 1 Region: 36-497
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 1.44e-166
Family Type II DNA topoisomerase 0.000000000723
Further Details:      
 
Domain Number 2 Region: 519-809
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 2.09e-47
Family GyrA/ParC C-terminal domain-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9RND4
Sequence length 829
Comment (tr|K9RND4|K9RND4_SYNP3) DNA topoisomerase (ATP-hydrolyzing) {ECO:0000256|SAAS:SAAS00993483} KW=Complete proteome; Reference proteome OX=195253 OS=Synechococcus sp. (strain ATCC 27167 / PCC 6312). GN=Syn6312_0203 OC=Synechococcus.
Sequence
MAEQLNLLSEGNIIPTALHTEMQQSYLEYAMSVIIGRALPDVRDGLKPVHRRILYAMYEL
GLTPDRPYRKCARVVGDVLGKYHPHGDQSVYDALVRLVQTFSSRYPLLDGHGNFGSVDDD
PPAAMRYTETRLAPISNTAMLTEVGLATVDFAPNFDNSQQEPLVLPAQLPILLLNGSSGI
AVGMATNIPPHNLNEVVDALIALIDRPEISLPELMQHLPGPDFPTGGQIIDTQGIIQAYE
TGRGLVTLRGVAQIEEIQPGRGRHRRSAIIVTELPFQVNKAAWIEKIADLSNQGRLEGIA
DLRDESDRDGMRVVIELKREGNPQKVLEQLYRQTVLQTNFGVILLAIVNGQPRQLSLIQL
LQEFLNFREETLIRRYQHELDQAQTRSHIVEGLLAGLNDLDRLIDLLRQAPDGPTAKINL
QTEFDLSDRQADALLAMPLRRLTGLERENLEREFQELSQRIQDLQTLLGSRHELLKALKK
ELRQLKRQFGDPRRTQILTDVPDLPVISTAEVDTPPDLPVMVEVSQKGYGRCLTSLARNS
FVIPPQAKQQWQDAKKDYPIFQAPGQRQHTLYLVGSNGKAYSVPVAKIPLTERNQKGQPL
QTLLPDSAQGEQLIQFWLEPATDAADSYPDFVLLTHQARIKRIPATELTGMNQRALQLIK
LKDDDALDWVIPILPAQTLIVATSTSRILRFQGETIPIMSRTSAGVAAFKLGTQERIIGA
IATSETTNLLLVTAQGYAKQISVNEVRPIHLGQLGTMTFKFTQPHDYVAGLVAVSPPFGA
EVPEVGLVTNRERWQRITVDQIPCGHHASSIQIVSMEPEELVTQILPSS
Download sequence
Identical sequences K9RND4
gi|427711364|ref|YP_007059988.1| WP_015122989.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]