SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9RSL2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K9RSL2
Domain Number - Region: 7-44
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000106
Family Rho termination factor, N-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9RSL2
Sequence length 418
Comment (tr|K9RSL2|K9RSL2_SYNP3) Uncharacterized protein {ECO:0000313|EMBL:AFY60279.1} KW=Complete proteome; Reference proteome OX=195253 OS=Synechococcus sp. (strain ATCC 27167 / PCC 6312). GN=Syn6312_1087 OC=Synechococcus.
Sequence
MPKEQPPLEDMTLRQLRRVASEFQVSRYSRMRKDQLLDAIREKQVVVPAATQPVPPRLES
QEKVEAAKFDLGPAVDLDDTLATVDEGLGDLPAGYGASRIVLMPRDPQWAYTYWDIPNEH
REELRRQGGQQLALRIYDATNVNLDQQIPHSVQEYPCDELAREWYLPIPVSDRDYVVEIG
YRCGDGRWLALSRSAPVRVPPTYPSDWIWDQFITVDWDLDLQGKTLFNLGTPESVETEVP
TSPIYDSIFGMAQGVEAQRVAGSLYGSMQMIPSSAELLPSQAISSYVFPSGVGLWAVPTT
SGLTMSGVGFSASVPPVKPRQFWLVADAELIVYGATEPDATVTIGGKVIELSPDGTFRFQ
MSFQDGLIDFPIQAVAADGEQNREIHMKFTRETPARRTNAKAEAVQEWFVNGEWKAPV
Download sequence
Identical sequences K9RSL2
WP_015123823.1.5248 gi|427712198|ref|YP_007060822.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]