SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9RU18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9RU18
Domain Number 1 Region: 16-225
Classification Level Classification E-value
Superfamily Ribosomal protein L1 6.67e-75
Family Ribosomal protein L1 0.000000555
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9RU18
Sequence length 236
Comment (tr|K9RU18|K9RU18_SYNP3) 50S ribosomal protein L1 {ECO:0000256|HAMAP-Rule:MF_01318} KW=Complete proteome; Reference proteome OX=195253 OS=Synechococcus sp. (strain ATCC 27167 / PCC 6312). GN=Syn6312_1885 OC=Synechococcus.
Sequence
MAKVSKRLRELQAKVEDRPYAPLDALNLLKETATAKFPESAEAHIRLGIDPKYTDQQLRT
TVALPKGTGQTVRVAVIARGEKVNEATQAGADIAGSEELIDEIQKGMMDFDLLIATPDMM
PQVAKVGRILGPRGLMPSPKAGTVTFDLPQAISEFKAGKLEFRADRTGIVHVLFGKASFP
AEDLLVNLKALQETIDRNRPSGAKGRFWRSIYVAATMGPSIQVDISGLRDLKFGEV
Download sequence
Identical sequences K9RU18
WP_015124569.1.5248 gi|427712945|ref|YP_007061569.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]