SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9RUP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9RUP7
Domain Number 1 Region: 9-194
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 3.77e-41
Family Phosphoglucomutase, first 3 domains 0.001
Further Details:      
 
Domain Number 2 Region: 261-391
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.18e-27
Family Phosphoglucomutase, first 3 domains 0.001
Further Details:      
 
Domain Number 3 Region: 394-483
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 2.22e-20
Family Phosphoglucomutase, C-terminal domain 0.006
Further Details:      
 
Domain Number 4 Region: 166-274
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.45e-19
Family Phosphoglucomutase, first 3 domains 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9RUP7
Sequence length 486
Comment (tr|K9RUP7|K9RUP7_SYNP3) Phosphomannomutase {ECO:0000313|EMBL:AFY61009.1} KW=Complete proteome; Reference proteome OX=195253 OS=Synechococcus sp. (strain ATCC 27167 / PCC 6312). GN=Syn6312_1868 OC=Synechococcus.
Sequence
MFWQGITSSSPIKFGTDGWRGVIGAEFTFERLIRAAQAAALVLNTTYGPSTHSQQIIVGY
DRRFLAEEFAQAVAETLKDLGFDVLLANQFAPTPAFSWAVKQHKALGALVITASHNPGIY
SGLKVKGAFAGSVPPEVTEKIEEELTRPHLHVQARTGSMTPFDPWPSYCQALQQKVDLPA
IQTAIKTHHLTVWADVMHGSAAGGLGRILGQPIHELNSGRDPLFSGGAPEPIGKYLQASC
ARIRQAAQETQGKTVGLVFDGDADRIAAIDAQGNLLTAQQLIPILIDHLTVQHGYRGEVI
KSISSSDLIPKVVALHGLSLYETPIGFKYIGDRMLMGGDVLLGGEESGGIGYGNHTPERD
ALLSALYVLEAVVKSGLDLAAYYQSLQVKTGFTSYYDRIDLHLPNLAAKDNLQHLLETNP
PQTVLETPVEKLQTIDGFKFHLGDHGWLLIRFSGTEPLLRLYCESISPERVQATLNWAKA
WAETIS
Download sequence
Identical sequences K9RUP7
WP_015124552.1.5248 gi|427712928|ref|YP_007061552.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]