SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9RVH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9RVH5
Domain Number 1 Region: 4-462
Classification Level Classification E-value
Superfamily L-aspartase-like 2.98e-159
Family L-aspartase/fumarase 0.0000000000629
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9RVH5
Sequence length 464
Comment (tr|K9RVH5|K9RVH5_SYNP3) Iron-independent fumarase {ECO:0000256|HAMAP-Rule:MF_00743} KW=Complete proteome; Reference proteome OX=195253 OS=Synechococcus sp. (strain ATCC 27167 / PCC 6312). GN=Syn6312_2346 OC=Synechococcus.
Sequence
MHQTRTESDTMGPMEVPADRYWGAQTARSLHHFAIGGQTMPREMIQALGILKQAAAMVNL
ELGELEAEPANLIIQAAQEVIEGTLDDHFPLRIWQTGSGTQTNMNANEVIANRAIELAGG
VLGSKHPVHPNDHVNCSQSSNDTFPTAMHIAAVQSLQQRLIPALSEMERVLAEKAQAWKG
VIKIGRTHLMDAVPLTFGQEFSGYQAQLMQNLGRIQSVLPHLSELAIGGTAVGTGLNTHP
EFAIRVAAKIAELTGLPFVSAPNKFAALAGHDAMVMASGVLRTLAGSLMKLANDISWMGS
GPRCGLGELILPPNEPGSSIMPGKVNPTQCEALTMVCVQVMGLDAAIGYAGSQGNFELNV
FKPMIIYNLLTQIELLTDACRCFTEFCLTGLEINYPQVEQYVENSLMLVTALNPHIGYDK
AAQVAKKAYAENLSLKQAAVDLGFLTAEQFDEWIQPAAMTQPHS
Download sequence
Identical sequences K9RVH5
gi|427713377|ref|YP_007062001.1| WP_015125001.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]