SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9RXH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9RXH8
Domain Number 1 Region: 2-142
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 8.63e-40
Family N-terminal domain of MutM-like DNA repair proteins 0.00018
Further Details:      
 
Domain Number 2 Region: 137-226
Classification Level Classification E-value
Superfamily S13-like H2TH domain 9.94e-30
Family Middle domain of MutM-like DNA repair proteins 0.0011
Further Details:      
 
Domain Number 3 Region: 226-277
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.94e-17
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9RXH8
Sequence length 280
Comment (tr|K9RXH8|K9RXH8_SYNP3) DNA-(apurinic or apyrimidinic site) lyase MutM {ECO:0000256|HAMAP-Rule:MF_00103} KW=Complete proteome; Reference proteome OX=195253 OS=Synechococcus sp. (strain ATCC 27167 / PCC 6312). GN=Syn6312_2684 OC=Synechococcus.
Sequence
MPELPEVETVRRGLAELTLDVPILGGEVLYPKTVAYPLDPDEFISGLVGQSLQAWERRGK
YLIGKLNSRGWLVVHLRMTGQLFWLSQEIPMAKHTRVRLFFGSGQELRFVDQRTFGQMWW
LPAADLLPQLMPTLAGLGPEPLGPDFTVSYLAQKLQHPHKPIKNALLDQALIAGIGNIYA
DEALFLAQIHPQARCCDLTPVQIQTLHQKIKAVLQLSLAVGGTTFNTFTSVEGINGNYGG
QAWVYGRKGQPCRVCQTPIQQIRLGGRSAHFCPQCQPLTN
Download sequence
Identical sequences K9RXH8
WP_015125314.1.5248 gi|427713691|ref|YP_007062315.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]