SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9RZ01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9RZ01
Domain Number 1 Region: 73-421
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.23e-76
Family Extended AAA-ATPase domain 0.0000000106
Further Details:      
 
Domain Number 2 Region: 8-43
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000105
Family ClpX chaperone zinc binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9RZ01
Sequence length 440
Comment (tr|K9RZ01|K9RZ01_SYNP3) ATP-dependent Clp protease ATP-binding subunit ClpX {ECO:0000256|HAMAP-Rule:MF_00175, ECO:0000256|SAAS:SAAS01014625} KW=Complete proteome; Reference proteome OX=195253 OS=Synechococcus sp. (strain ATCC 27167 / PCC 6312). GN=Syn6312_3686 OC=Synechococcus.
Sequence
MPKYDAHLKCSFCGKSQEQVRKLIAGPGVYICDECVELCNEILDEELSSLGVAPRRDPQP
ERPRKPRSTLPPFNQIPKPREIKHYLDDHVVGQDEAKKVLSVAVYNHYKRLSLLEHPAKG
TEDHVELQKSNILLIGPTGSGKTLLAQTLAKMLDVPFAVADATTLTEAGYVGEDVENILL
RLLQTANLDVEEAQRGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKMLEGTTANVP
PQGGRKHPYQDCIQIDTTNILFICGGAFVGLEKVVEQRVGKKAMGFVRDGESQAKEKRTA
DILKNLEPGDLVKFGMIPEFIGRIPVVAVLESLDESALVRILTEPRNAILKQYKKLLHMD
NVQLEFHPAAIQAIAQEAHRRKTGARALRAIVEEIMLDVMYELPSRKDLTRCQITPEMVE
KRSTAELLLHPSSIPTPESA
Download sequence
Identical sequences K9RZ01
WP_015126235.1.5248 gi|427714617|ref|YP_007063241.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]