SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9S3S3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9S3S3
Domain Number 1 Region: 80-426
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.57e-74
Family Extended AAA-ATPase domain 0.00000000979
Further Details:      
 
Domain Number 2 Region: 8-43
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000171
Family ClpX chaperone zinc binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9S3S3
Sequence length 445
Comment (tr|K9S3S3|K9S3S3_9CYAN) ATP-dependent Clp protease ATP-binding subunit ClpX {ECO:0000256|HAMAP-Rule:MF_00175, ECO:0000256|SAAS:SAAS01014625} KW=Complete proteome; Reference proteome OX=1173025 OS=Geitlerinema sp. PCC 7407. GN=GEI7407_0296 OC=Coleofasciculaceae; Geitlerinema.
Sequence
MSKYDSHLKCSFCGKSQEQVRKLIAGPGVYICDECVDLCNEILDEELFDSSAAAPQPAPR
REQTPEKRHTRSSNLSLGQMPKPQEIKKYLDEHVIGQESAKKILSVAVYNHYKRLSYIQG
KGKGDFDDAVELQKSNILLIGPTGCGKTLLAQTLAEILDVPFAVADATTLTEAGYVGEDV
ENILLRLLQVADLDVEEAQRGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKMLEGT
VANVPPQGGRKHPYQDCIQIDTSNILFICGGAFVGLEKSVEQRIGKKSIGFVQPNDPMSK
EKRAADVLKHLEPDDLVKFGMIPEFIGRVPIVAVLDPLDEDALTEILTEPRNALVKQYQK
LLKMDNVQLEFKQEAVRAIAQEAYRRKTGARALRGIVEELMLDVMYELPSRKDVTRCLIT
REMVEKRSTAELLMHPSSLPKPESA
Download sequence
Identical sequences K9S3S3
WP_015170368.1.54702 gi|428223755|ref|YP_007107852.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]