SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9S5Q1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9S5Q1
Domain Number 1 Region: 126-216
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.62e-18
Family Middle domain of MutM-like DNA repair proteins 0.0011
Further Details:      
 
Domain Number 2 Region: 2-125
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 7.98e-17
Family N-terminal domain of MutM-like DNA repair proteins 0.0000214
Further Details:      
 
Domain Number 3 Region: 236-271
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000399
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9S5Q1
Sequence length 273
Comment (tr|K9S5Q1|K9S5Q1_9CYAN) DNA glycosylase/AP lyase, H2TH DNA-binding protein {ECO:0000313|EMBL:AFY65947.1} KW=Complete proteome; Reference proteome OX=1173025 OS=Geitlerinema sp. PCC 7407. GN=GEI7407_1455 OC=Coleofasciculaceae; Geitlerinema.
Sequence
MPEGPEIRRAADQVERAIARQPLTEIFFAFEHLKPYETKLVTQEIRGVETKGKGMLICFA
QGLNIYSHNQLYGQWMVRRAQDYPPTNRQLRLAIHTAQKSALLYSASDIEVLADAELATH
SFWGRVGPDVLNPETTPEQVRDRLLAPEFRRRRLTTLLLDQHFLAGLGNYLRSEVLFVAR
VHPARRPLDCTPDQMARLAEGAIALPRQSYETGGITNDLTLAQSLKAAGQPRRLYRHWVF
GRDGQPCFVCETPIEKIDAGGRRCYYCPQCQSA
Download sequence
Identical sequences K9S5Q1
WP_015171514.1.54702 gi|428224902|ref|YP_007108999.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]