SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9S7C8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9S7C8
Domain Number 1 Region: 49-233
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 7.85e-38
Family Pentapeptide repeats 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9S7C8
Sequence length 237
Comment (tr|K9S7C8|K9S7C8_9CYAN) Pentapeptide repeat protein {ECO:0000313|EMBL:AFY66527.1} KW=Complete proteome; Reference proteome OX=1173025 OS=Geitlerinema sp. PCC 7407. GN=GEI7407_2047 OC=Coleofasciculaceae; Geitlerinema.
Sequence
MTIEELLQQYLQGKRRFWGAALREAELMNVALGGIDLSYGDLRHIRIGKANLSRASLRQT
DLSEAILWGTDLSEADLYQAVLREADLTGAKLVQARLDEAVLLKASLGGANLTRAKLAQA
MLIHADLRPSSDQRTDLGWADLTRADLSYADLGAATLRHANLTHAKLCRANLSRRSQWGD
VVTDLSHACLRHADLSYADLRGAALHEADLRGADLTGTLLEGADLQGATMPDGTVQG
Download sequence
Identical sequences K9S7C8
WP_015172093.1.54702 gi|428225482|ref|YP_007109579.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]