SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9SDE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9SDE6
Domain Number 1 Region: 7-462
Classification Level Classification E-value
Superfamily L-aspartase-like 6.63e-139
Family L-aspartase/fumarase 0.00000000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9SDE6
Sequence length 470
Comment (tr|K9SDE6|K9SDE6_9CYAN) Fumarate lyase {ECO:0000313|EMBL:AFY67996.1} KW=Complete proteome; Reference proteome OX=1173025 OS=Geitlerinema sp. PCC 7407. GN=GEI7407_3529 OC=Coleofasciculaceae; Geitlerinema.
Sequence
MTEPSAYRIEKDSMGERQIPESAYYGIQTLRATENFPISGLKPLPTYVEACVLIKKAAAI
ANGQLGCISAEMAQAIVQAADEVLAGSLREQFVVDVYQAGAGTSHHMNVNEVLANRALEL
LGDQKGNYGRVSPNDHVNYGQSTNDVIPTAIRVGGLLALERTLIPALTEAITALDAKADE
FQNIIKSGRTHLQDAVPVRLGESFRAWAQILMDHLVRIETAATDLTLLGLGGSAAGTGLN
THPQYRFRVAEILGELIDQPLKPAPHLMAAMQSMGPFVAVSGTLRNLAQDLAKISHDLRL
MDSGPKTGFKEIQLPPVQPGSSIMPGKYNPVMAEMTSMVCFQVMGYDAAIALAAQAGQLE
LNVMMPLIAYNLIQSIEILGNTIAALTERCLKGITASEERCLAYAEGSLALVTALNTHIG
YLNAAAVAKESLETGKSLRQIVLEKGLMDEATLAEVLNLAEMSQMPPNQA
Download sequence
Identical sequences K9SDE6
gi|428226951|ref|YP_007111048.1| WP_015173560.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]