SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9SDX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9SDX5
Domain Number 1 Region: 38-101
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.01e-19
Family Pentapeptide repeats 0.0033
Further Details:      
 
Domain Number 2 Region: 146-222
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000000000000275
Family Pentapeptide repeats 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9SDX5
Sequence length 233
Comment (tr|K9SDX5|K9SDX5_9CYAN) Pentapeptide repeat protein {ECO:0000313|EMBL:AFY68797.1} KW=Complete proteome; Reference proteome OX=82654 OS=Pseudanabaena sp. PCC 7367. GN=Pse7367_0487 OC=Pseudanabaena.
Sequence
MNGSKSFEEFQEIVKKVVALKSDDFFEIAKVTGLDPKSDFVGADLSGVDISHHDLSGANF
SGTDLRDANLRGTNLSEANLRGIDLSGADLSGASLFHVNPLKIGGMDISDFRKSVTLPDL
LKIVLEHEAFANDMEIQSKQSFRAIGANFVEADLKQARLPFAYFSNADMSKADLRGANLN
QATLHGAKFDGAQVSEAIFLGSKGLSQSDIEDLKSRGAIFDLADINVPALVPS
Download sequence
Identical sequences K9SDX5
gi|428216760|ref|YP_007101225.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]