SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9SGR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9SGR3
Domain Number 1 Region: 5-181
Classification Level Classification E-value
Superfamily RL5-like 4.94e-73
Family Ribosomal protein L5 0.000000371
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9SGR3
Sequence length 181
Comment (tr|K9SGR3|K9SGR3_9CYAN) 50S ribosomal protein L5 {ECO:0000256|HAMAP-Rule:MF_01333} KW=Complete proteome; Reference proteome OX=82654 OS=Pseudanabaena sp. PCC 7367. GN=Pse7367_1091 OC=Pseudanabaena.
Sequence
MAKQRFLESYQTQAVPKLIEQFKYTNSHQVPKFNKVVVNRGLGEASQNAKALESSITEIS
VITGQKPVVTRARKAIAGFKLREGMPVGVMVTLRRERMYAFLDRLINFSLPRIRDFRGIS
AKSFDGRGNYTLGVREQLIFPEISYDSIDQIRGMDISIITTANTDEEGRALLAAMGMPFR
K
Download sequence
Identical sequences K9SGR3
WP_015164361.1.5078 gi|428217351|ref|YP_007101816.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]