SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9SIV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9SIV3
Domain Number 1 Region: 260-362
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 2.75e-19
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0024
Further Details:      
 
Domain Number 2 Region: 194-258
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.00000000000752
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.004
Further Details:      
 
Domain Number 3 Region: 113-192
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.00000000017
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9SIV3
Sequence length 385
Comment (tr|K9SIV3|K9SIV3_9CYAN) MscS Mechanosensitive ion channel {ECO:0000313|EMBL:AFY69724.1} KW=Complete proteome; Reference proteome OX=82654 OS=Pseudanabaena sp. PCC 7367. GN=Pse7367_1433 OC=Pseudanabaena.
Sequence
MIIPIATIITKLIMLHEILQQEFLGNPVSNYALAMATVAIGLAAVQIIETIIIRRLKKWT
EHTENDLDDRLISLVDRSLIPILYVTVFYLAFQDLIFSETIDEVIRVVGTVALTVFIIRF
VNALIASVLEFYWLTKRDEITRTKSLSLLLPAIRIIIWAIGMVFLLDNLGFQISAVLTSL
GIGGVAIGLASQGLFEDVFSYFAILLDSPFEISDFLVIGDFAGTVEHIGVKTTRIRSLEG
EQVIFSNKALTNSRIQNYKRMYRRRIAFQIGITYDTPLEKLRQIPNLIKDTIVNTQSATF
DRAHFFAYGDFSLIYEIVYYVNSNDYNIYMDVQQQINFTIKQEFEQRAIEFAFPTQTLHV
SNNGGESNGNNSNNHKAQNFAAVKQ
Download sequence
Identical sequences K9SIV3
WP_015164693.1.5078 gi|428217687|ref|YP_007102152.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]