SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9SQA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9SQA2
Domain Number 1 Region: 431-765
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.57e-90
Family WD40-repeat 0.0000127
Further Details:      
 
Domain Number 2 Region: 652-1010
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.02e-80
Family Quinoprotein alcohol dehydrogenase-like 0.034
Further Details:      
 
Weak hits

Sequence:  K9SQA2
Domain Number - Region: 40-249
Classification Level Classification E-value
Superfamily PP2C-like 0.000445
Family PP2C-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9SQA2
Sequence length 1057
Comment (tr|K9SQA2|K9SQA2_9SYNE) WD40 repeat-containing protein {ECO:0000313|EMBL:AFY72767.1} KW=Complete proteome; Reference proteome OX=1173263 OS=Synechococcus sp. PCC 7502. GN=Syn7502_00618 OC=Synechococcus.
Sequence
MPSSDELSSGRLLQRSLLPQAIPSYLGLDIAADVWTAVDLGGDYYQFLEQPGILGVAIAD
SSGKSVAGAIHAALFKGQLDAFATQGRLRNPTTVMTSLNQLLCATNTDDAVALAYGVLDL
ETYEFQIGNAGIPGPVIYRAATKSCEETVNPSMALGRYEGIPYRTLTKPFNEGDIAIFFS
DGLYEASNANGDEFGTANDKGISPLKFVISSLAHLPAAKILVGLKLALDKFTGREIPEDD
VSIVVIKLNQKVAMTKTRDCPYQEALQAWMRSDEKDDSALLRGTRLVEALGWAKAQPSLS
RLDTEFLEASERVNEREQMQAQLLEAATSRAAAADRLEKLSQDLAKSLESEKQQRIQAEM
GEISERIVALTMSSEALFLSHNHIEALISSVIAGVKIRQLTSQVTNGIAHLKANTQIRTI
TALEQVIYGIHEYNRYEGHGFWVNKVCFSADGKFLVSASSDRTIKVWNINGTLLQTLYGH
TNWVTSVAISPNGKMIASASRDNMIRLWNWDQTIGAFKETGSTMLKGHDGPVLDVCFSSD
GEYIASAGEDTTVRLWKANGTLIKTFRGGHERWVTCVAFNPNGKEVVSGSADRTLIIWNI
NGAVVKTLKGHDSFVEAVAYEPHGQAIISGSRDRTMKLWGSDGVLLRTFHGHTDKLWSVA
YSPDGKTIASAGSDRTIKVWDTDGTLLRDLAGHGDAVNSIAFSPDGKSLASASRDTTVKL
WNIRGNPLRKLLAQDDVWAAAFSPNGKFIATGGKDKNVNIWNMAGNLVASLSGHNDAINS
ICISPDSSVILSASTDSSIKSWSPDGRAIDTLNGHRSEVYCLSFRSDGQVFASASADNSV
RLWSADGVWLQTLNGHTAEVYAVCFSPDGSMLVTAGKDKIINLWSWDGRLVYSFEGHSAE
VLTLCFSSDNSTFASGSMDQSVKIWSVDGSLLKTLNGHSAEVRSICFSPDGKTIASASED
TLVQLWSLDGTLLRTFNGHKSAVKSISFSANGKILMSASADKSVILWNLDLDNLLMRGCS
WLQEYLKTNTNVSEEDRRNCLGGCSWLYKHLKSNAAS
Download sequence
Identical sequences K9SQA2
gi|428220732|ref|YP_007104902.1| WP_015167426.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]