SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9SRC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9SRC8
Domain Number 1 Region: 16-363
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 8.77e-72
Family Iron-containing alcohol dehydrogenase 0.0000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9SRC8
Sequence length 372
Comment (tr|K9SRC8|K9SRC8_9SYNE) Glycerol dehydrogenase-like oxidoreductase {ECO:0000313|EMBL:AFY72526.1} KW=Complete proteome; Reference proteome OX=1173263 OS=Synechococcus sp. PCC 7502. GN=Syn7502_00362 OC=Synechococcus.
Sequence
MNAMKTVINSLPILAIAPSQVIRGQGIVHKLVDYLPTWLQGSGKSALIISGTKSKASVKT
ALDQADIPIHYADPIENCSEVNLKKLQAEITKHQPHFIIGCGGGKVLDTAKLIAHQHNLP
IVTIPTTAATCAAWTALSNVYTEAGAFSYDVVLSRCPDLILVDYDLISTAPQRTLIAGIG
DAIAKWYEASVSSGSSDKTLVIAAVQEARILRDILFQKSTEALQNPTGSVWQEVVDATVC
LAGIIGGMGGAQCRTVAAHAVHNGLTHLPQSHHTLHGEKVAYGILVQLRLEEFQGNQLAA
TARQQLLKFYSEIKLPQNLGDLALGDITLKELETVAAIACKGGSDLHNLPFYVHEHQLIA
AMVSTTVPLVAA
Download sequence
Identical sequences K9SRC8
gi|428220491|ref|YP_007104661.1| WP_015167185.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]