SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9SUA3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9SUA3
Domain Number 1 Region: 184-327
Classification Level Classification E-value
Superfamily CheY-like 1.37e-41
Family CheY-related 0.0013
Further Details:      
 
Domain Number 2 Region: 359-593
Classification Level Classification E-value
Superfamily PP2C-like 0.00000000628
Family PP2C-like 0.014
Further Details:      
 
Domain Number 3 Region: 16-75
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000314
Family Homodimeric domain of signal transducing histidine kinase 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9SUA3
Sequence length 595
Comment (tr|K9SUA3|K9SUA3_9SYNE) Serine phosphatase RsbU, regulator of sigma subunit {ECO:0000313|EMBL:AFY73740.1} KW=Complete proteome; Reference proteome OX=1173263 OS=Synechococcus sp. PCC 7502. GN=Syn7502_01686 OC=Synechococcus.
Sequence
MDNIFSEFSQDHNLSGLIIKLRHDFRTPINAIIGYSEMLLEDLETEDNEIISGFQKINVG
GHELLSIVNQNLDNSLEKSLKAILGLSPILEAVNIESNSSLQRVIENCQLLKNDQSLTSL
IPDIERIEVSAFRFRELLNKCLQAALTASELQSIDPNNQSVNNLVKEISHDLLKKNHFIE
NQTCHLLVVDDNENNRDLFTRQLQREGYIVTTATNGQEALTMIKTGEYELVLLDLMMPIL
DGYQALKMLKADEQWQHIPVIMISASDEIDQVVRCIEIGAEDFLPKPFNPILLKARIGAA
LDKKRFRDRERQYLQQVEIYSQKLNQELEKGRQMQLNFLPPELLQVPNWEISAFFKPARQ
VAGDFYDTFPVLEKYVGLVIADVCDKGVGAALFMALFRSLIRIFASQTAMRNFYQHLTLD
SSGKSEKLTDSSYIAELTPTNVLEAVALTNNYVAEYHGDLGMFATLFFGVLDPQTGILYY
INGGHEPLFIINSEGKIEQKLNSTGPAVGMMPNMKFRVEQAQLQAGDILIGYTDGVPEAR
AFGGEFFTDQKLLNILTKPISSVSQLLTEITENVINHIGEADQFDDITLLAIQRN
Download sequence
Identical sequences K9SUA3
gi|428221705|ref|YP_007105875.1| WP_015168397.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]