SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9SW80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9SW80
Domain Number 1 Region: 10-231
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 3.53e-51
Family Isochorismatase-like hydrolases 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9SW80
Sequence length 233
Comment (tr|K9SW80|K9SW80_9SYNE) Nicotinamidase-like amidase {ECO:0000313|EMBL:AFY74877.1} KW=Complete proteome; Reference proteome OX=1173263 OS=Synechococcus sp. PCC 7502. GN=Syn7502_02953 OC=Synechococcus.
Sequence
MLKSSRPAQELILVPTRQHDFPLVLGKTALLVIDMQNGFCHPEGFCGHELGADLSAVRQI
IPNIQAAIAWAREQGLLIIYTRESHLPDLSDVTPSKAQRYINAGYPIGSLGKMGRFLIQG
ELGTNLIAEIQPLDSELQIDKPAQSIFIGTELDKILAQRNITHLLFTGVTTACCVLASYR
QASDLGFYTLLLEDCCGAMSPVEHQAAIDVILTENGAIGWVTSFDNLREFLGR
Download sequence
Identical sequences K9SW80
WP_015169528.1.58188 gi|428222842|ref|YP_007107012.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]