SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9W8D8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K9W8D8
Domain Number - Region: 88-162
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000115
Family Collagen-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9W8D8
Sequence length 165
Comment (tr|K9W8D8|K9W8D8_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:AFZ16498.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_0582 OC=Microcoleaceae; Microcoleus.
Sequence
MSIVRSNPMSTAVSFRLILGFLLLNVVQIAESTPTRAQPLTVKISKEDSTVSEPTTFKST
LIIAQQSRTRRIRFARGASSALVEDAVVRGTRDIYRLGAKAGQKMTVSITSVENNAVFDI
ISPKQKLLKQEATSWTTQLPATGDYSIVVGGTRGNATYKLRVEIK
Download sequence
Identical sequences K9W8D8
WP_015180662.1.75295 gi|428308927|ref|YP_007119904.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]