SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9WAG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WAG6
Domain Number 1 Region: 380-426
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.00000000034
Family GSPII protein E N-terminal domain-like 0.02
Further Details:      
 
Domain Number 2 Region: 314-360
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.00000126
Family GSPII protein E N-terminal domain-like 0.024
Further Details:      
 
Weak hits

Sequence:  K9WAG6
Domain Number - Region: 116-205
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00365
Family Tyrosine-dependent oxidoreductases 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9WAG6
Sequence length 450
Comment (tr|K9WAG6|K9WAG6_9CYAN) Exopolysaccharide biosynthesis protein, WecB/TagA/CpsF family {ECO:0000313|EMBL:AFZ16497.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_0581 OC=Microcoleaceae; Microcoleus.
Sequence
MTTTTVRPADFSADFSEVERLPNLSVHLLSRRITCMPVASIVEAINSACIQGRKITVANY
NVHSFNLSMLLPWFYNFLQSAEITHCDSTGILKALEFMGLKLPLEYRASYTALMPALLEH
CNKQGFSIFLLGSKPECLEAAIDQLKSEYPNIRVDGHHGYFDIEDLDQNEAVIQKINIAK
PNILVVGMGMPRQENWIRLHRSRLNVNVIMAGGAVIDRLAGIVSDCPSFLSEWGLEWFYR
LCREPKRLAVRYLLGNPAFVLLLALAKFYASPLEVEDIPFNSTSTLKLQKYRPNSSSTLK
NQNRFLAIVHPDDRHLGRYLVEAGLLTPLQLKTALSEQQVTGLRLSELIVRKRWLKQQTV
EFLMEKLLLREHAVVQTDDKRLGHYLVEAGLLTQAQVETALSEQKGTGQRLGEVIVRKGW
IQEQTVEFLIKQVILSERALFTRALAYKQG
Download sequence
Identical sequences K9WAG6
gi|428308926|ref|YP_007119903.1| WP_015180661.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]