SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9WDF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WDF4
Domain Number 1 Region: 158-378
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 7.44e-57
Family ATP-binding domain of peptide synthetases 0.00011
Further Details:      
 
Domain Number 2 Region: 3-157
Classification Level Classification E-value
Superfamily PreATP-grasp domain 6.04e-33
Family D-Alanine ligase N-terminal domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9WDF4
Sequence length 381
Comment (tr|K9WDF4|K9WDF4_9CYAN) D-alanylalanine synthetase {ECO:0000256|HAMAP-Rule:MF_00047} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_1987 OC=Microcoleaceae; Microcoleus.
Sequence
MAKIRVGLLFGGCSGEHEVSMSSARAIAKALSSDQNANHYELLPVYIQKDGIWQSGELAQ
HVLESGKALPLTGTNEAYLPTSAADAPSSSASSEILPSAATASKLSRVGENIGWSEVDVW
FPILHGPNGEDGTIQGLLKLMQVPFVGSGVLGSALGMDKIAMKMAFTQAGLPQVKYMAVN
RSQIWSNPCVFPKVCDQIEANLGYPCFVKPANLGSSVGIAKVRSRPELEAALDNAASYDR
RIIVEAGVVAREVECAVLGNDQPKASVVGEITYNSDFYDYETKYTEGQADLLIPASLPDS
VATQIQEMALQAFAAVDAAGLARVDFFYIEETGEVLINEINTMPGFTATSMYPQLWAATG
IPFPQLVNQLIELAMERHQSP
Download sequence
Identical sequences K9WDF4
WP_015181988.1.75295 gi|428310265|ref|YP_007121242.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]