SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9WFG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WFG3
Domain Number 1 Region: 14-148
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.18e-37
Family Pentapeptide repeats 0.00016
Further Details:      
 
Domain Number 2 Region: 116-232
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 4.32e-29
Family Pentapeptide repeats 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9WFG3
Sequence length 411
Comment (tr|K9WFG3|K9WFG3_9CYAN) Putative low-complexity protein {ECO:0000313|EMBL:AFZ19125.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_3394 OC=Microcoleaceae; Microcoleus.
Sequence
MNADELLERYAAGERCLRGADLHGADLRGVDLRGIDLSDANLSDTDLSDADLRDADLIGA
NLRGADLIVASLSAADLRDANLHDANLIGAKLGVANLRDADLSGANLSGAELSCTDLTCS
NLNGAYISGANLIKAKLSRANLQGANLSVTNMIGADLSGANLQGANLGGANLIEADLGGA
NLQGAKLSRSNLAYVNLANSDLSNADLSDSNLAGTNLTNADLDNTNLEGTILSLGISLNI
RNPDQTAPYEWNGLYLHSKTELKIAEAFDRAGVPFYLNGWTRIHSTQHIDSKEIDFLVFY
QSKWGILEVNGEPSEPPVCTLYEPERISLCATDAPNIVTTSLSGDHESVGGLNPASLRSA
ERSIVAPQELRLFKIPHISIVEHYEATRCWDEPDTVVQEFLEILTQASNVP
Download sequence
Identical sequences K9WFG3
gi|428311554|ref|YP_007122531.1| WP_015183268.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]