SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9WFX4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WFX4
Domain Number 1 Region: 8-219
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 5.1e-53
Family Isochorismatase-like hydrolases 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9WFX4
Sequence length 225
Comment (tr|K9WFX4|K9WFX4_9CYAN) Nicotinamidase-like amidase {ECO:0000313|EMBL:AFZ19083.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_3351 OC=Microcoleaceae; Microcoleus.
Sequence
MVSISAQPYDYELPAHGGLALLIIDMQRDFLEEGGFGDALGNDVTRLRAIVPTLKELLAA
FRAYKLPIFHTIEGHQPDLSDCPPSKRHRGRGELKIGDVGPMGRILVLGESGNGIIPELQ
PLPGETVITKPGKGAFYNTHLESLLHEQGITHLLITGVTTEVCVQTTMREANDRGFECLL
VEDATESYFPAFKQSTLDMIVAQGGIVGWTASAANVLQSLAKWKS
Download sequence
Identical sequences K9WFX4
WP_015183226.1.75295 gi|428311512|ref|YP_007122489.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]