SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9WJX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WJX9
Domain Number 1 Region: 182-642
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.65e-120
Family Amylase, catalytic domain 0.00000000436
Further Details:      
 
Domain Number 2 Region: 650-752
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.52e-37
Family alpha-Amylases, C-terminal beta-sheet domain 0.00035
Further Details:      
 
Domain Number 3 Region: 15-117
Classification Level Classification E-value
Superfamily E set domains 3.64e-19
Family E-set domains of sugar-utilizing enzymes 0.0063
Further Details:      
 
Domain Number 4 Region: 140-199
Classification Level Classification E-value
Superfamily E set domains 0.000000035
Family E-set domains of sugar-utilizing enzymes 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9WJX9
Sequence length 767
Comment (tr|K9WJX9|K9WJX9_9CYAN) Glycogen branching enzyme {ECO:0000256|HAMAP-Rule:MF_00685} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_5063 OC=Microcoleaceae; Microcoleus.
Sequence
MSLTIAPEQIDRIVWNQHHDPFEVLGPHRFEQDGKTGWIVRAYLPNAEAAWVVCPEQRTE
YPMHSVHHPHFFEAKIEAKELANYQLRTKEGEHERVLYDPYAFRSPLLTDFDLYLFGEGN
HHRIYEKLGAHSVEIEGVKGVYFAVWAPNARNVSVLGDFNYWDGRKHQMRKGSTGVWDLF
IPGIGVGEHYKYEIKNYDGHIYEKSDPYGFQQEVRPKTASIVTDLDAYKWNDAEWMEQRR
HTDPLAHPISVYEVHLGSWLNASAAEPAQLPNGETEPVVLVSELRPGARFLTYRELAHRL
IPYVKELGFTHVELLPIAEHPFDGSWGYQVTGYFACTSRFGTPEDFMYFVDECHRNGIGV
IVDWVPGHFPKDGHGLAFFDGTHLYEHADPRKGEHKEWGTLVFNYNRNEVRNFLVANALF
WFDKYHIDGMRVDAVASMLYLDYCRKDGEWVTNQYGGRENIEAADFLRQTNHVIFSYFPG
VLSIAEESTDWPMVSWPTYVGGLGFNLKWNMGWMHDMLDYFHMDPWFRQFHQNNITFSMW
YHHSENYMLALSHDEVVHGKSNIIGKMPGDEWQKFANVRCLFTYMFTHPGKKTLFMSMEF
GQWSEWNVWADLEWHLLQYEPHQKLKQFITDLNQLYRSEPSLYSQDFAQEGFQWIDCSDN
RHSVVAFIRRSKDSGEFVVAVCNFTPQPHSHYRVGVPEMGFYTELFNSDAREYGGSNMGN
LGGKWTDEWSYHNQPYSLDLCLPPLGVLILKINHEKTQAALQHNWNE
Download sequence
Identical sequences K9WJX9
WP_015184853.1.75295 gi|428313149|ref|YP_007124126.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]