SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9WKD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9WKD2
Domain Number 1 Region: 1-147
Classification Level Classification E-value
Superfamily DTD-like 5.89e-55
Family DTD-like 0.0000278
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9WKD2
Sequence length 151
Comment (tr|K9WKD2|K9WKD2_9CYAN) Gly-tRNA(Ala) deacylase {ECO:0000256|HAMAP-Rule:MF_00518} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_4283 OC=Microcoleaceae; Microcoleus.
Sequence
MRVIIQRVKSSQVQVGNVVIGKIGKGLNLLVGIANTDTETELNWMARKCLDLRLFPGDES
IADRWEKSVQEIGGELLVVSQFTLYGDCRKGRRPSFSQSAAPDVAQQLYDKFVETLRQSG
LRVETGQFGAMMQVSIENDGPVTLLLEREHD
Download sequence
Identical sequences K9WKD2
gi|428312411|ref|YP_007123388.1| WP_015184118.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]