SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9WMY4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K9WMY4
Domain Number - Region: 117-154
Classification Level Classification E-value
Superfamily PKD domain 0.0388
Family PKD domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9WMY4
Sequence length 342
Comment (tr|K9WMY4|K9WMY4_9CYAN) Putative S-layer protein {ECO:0000313|EMBL:AFZ21114.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_5477 OC=Microcoleaceae; Microcoleus.
Sequence
MTNVPPPDPDSSRLGFDELLGIVIAFATIGTILAVTLGQRDKGFNLSRLLNPEARAPTAS
PSGVIPLPQQTPVPTVSPEATLLPGQEDIAPSPSPTSITRRLAAPVPTAQPVPAEAPQAG
STTIPIIVPAPLAEASPTPTPVAAATPIKFTDVPQDLWARPYIEALASRGIVSGFPDGTF
KPGGAITRAEFAALLQKAFEQQPTSTALNYKDVPTSHWALPAIDQSVKTGFFRGYPNNIF
RPNQPISKVQTIVALASGLGLKPTTVEQDVLKTYEDSNRIPNYAKAPVSAATTSGLVVNY
PNPNILNPNRNASRAEVAALVYQGMVESGKVEPMPSQYLVKP
Download sequence
Identical sequences K9WMY4
gi|428313543|ref|YP_007124520.1| WP_015185247.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]