SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9XCS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9XCS9
Domain Number 1 Region: 83-352
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.47e-62
Family BC ATP-binding domain-like 0.00000591
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily PreATP-grasp domain 6.91e-48
Family BC N-terminal domain-like 0.0000305
Further Details:      
 
Domain Number 3 Region: 331-442
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 6.28e-37
Family BC C-terminal domain-like 0.00024
Further Details:      
 
Domain Number 4 Region: 624-750
Classification Level Classification E-value
Superfamily Cyclophilin-like 3.3e-33
Family PH0987 C-terminal domain-like 0.012
Further Details:      
 
Domain Number 5 Region: 913-1043
Classification Level Classification E-value
Superfamily Cyclophilin-like 3.75e-27
Family PH0987 C-terminal domain-like 0.0011
Further Details:      
 
Domain Number 6 Region: 1119-1195
Classification Level Classification E-value
Superfamily Single hybrid motif 8.38e-20
Family Biotinyl/lipoyl-carrier proteins and domains 0.0016
Further Details:      
 
Domain Number 7 Region: 797-889
Classification Level Classification E-value
Superfamily PH0987 N-terminal domain-like 9.55e-20
Family PH0987 N-terminal domain-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9XCS9
Sequence length 1198
Comment (tr|K9XCS9|K9XCS9_9CHRO) Urea carboxylase {ECO:0000313|EMBL:AFZ30455.1} KW=Complete proteome; Reference proteome OX=1173026 OS=Gloeocapsa sp. PCC 7428. GN=Glo7428_1907 OC=Chroococcaceae; Gloeocapsa.
Sequence
MFNKVLIANRGEIACRVIRTLDRLGIASVAVYSEADAHAPHVSMATEAVCIGAAPVAESY
LRYDRILEVAQQTGAQAIHPGYGFLSENIEFAQACVAAGIMFIGPTPEQIRCFGLKHTAR
ELAEQNQVPLVPGTGLLESLADAQHAAAAIAYPVMLKSTAGGGGIGMQVCANDAELADAF
EKVQRLSQANFKQSGVFLEKYIQTARHIEVQIFGDGCGRVIALGERDCSTQRRNQKVIEE
TPAPGISDALRQQLYNCAVRLGQAVNYQSAGTVEFVFDVATQQFYFLEVNTRLQVEHGVT
EMVSGIDLVEWMVRLAAGDATFLENYTYQSQGHSIQVRIYAEDPHKNFQPSSGLLSAVRF
PKNLRCDGWIETGTEVTPFYDPLLAKLIVHGEDRAGAIAQLQAALNESEIAGIETNLDYL
RQVIASPAFIEGSVSTRYLNTFAYQPRTIDVLDGGTYTTIQDYPGRIGYWDIGVPPSGPL
DHLAFRLGNRILGNPESAPGLECTVMGPTLRFNCDTVICLTGAAMKATLDGEPVPFWTAI
PVSAGSTLKLKTIQGHGYRTYLAIQHGFDVPEYLGSKATFTLGQFGGHAGRTLRAGDVLR
LAQGEPKAIASLPAKLIPEYTNAWEIGVLYGPHGAPDFFTEEDIEMFFATRWTIHHNSAR
TGIRLIGPKPQWARTDGGEAGLHPSNIHDNAYAIGTIDFTGDMPIILAHDGPSLGGFVCP
ATIVQSELWKIGQLKPGDTVRFYRLTAAEARQRELEQDRQIETLAIAATQSKLTDVTNPL
SPILHEISPSPTQIAVTYRQAGDKFLLIEYGSLVLDLNLRFRVHALMEWLNANHVAGIVD
LTPGIRSLQVHYDSRVLPVQDLLNALTTAESQLPSIDDMEVPTRVVHLPLSWDDESTQLA
IQKYMQSVRADAPWCPSNIEFIRRINGLESIEQVREIVFNASYLVMGLGDVYLGAPVATP
LDPRHRLVTTKYNPARTWTPENAVGIGGAYMCIYGMEGPGGYQFVGRTVPVWNRYKQTED
FSQPWLLRFFDQIRFFPVSPAELLRYREDVIQGKVKLKIEEETFSLRQYCEFLQANASSI
AAFKAKQQAAFAAERDRWVAAGEFTRQESLQQSDESPTPEIVLADDVEAIVAHVSANVWQ
VLVKVGDQVESGDRLVILEAMKMEIAVLAEDSGTITDVFCQPGQTVTAGQFLAAIQLD
Download sequence
Identical sequences K9XCS9
WP_015188329.1.9315 gi|434392668|ref|YP_007127615.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]