SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9XD72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9XD72
Domain Number 1 Region: 59-99,137-391
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 2.35e-75
Family Acetamidase/Formamidase-like 0.0000698
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9XD72
Sequence length 398
Comment (tr|K9XD72|K9XD72_9CHRO) Acetamidase/Formamidase {ECO:0000313|EMBL:AFZ30565.1} KW=Complete proteome; Reference proteome OX=1173026 OS=Gloeocapsa sp. PCC 7428. GN=Glo7428_2020 OC=Chroococcaceae; Gloeocapsa.
Sequence
MRNNVTLRFKIKRVLERFTLKWRIVGVFAGIGLLLCSLNGVAWSSPTATPVRTHRIMSTP
ENVIWGELFKPESRPIARVRSGDRIIMQTVSHEGILPDQGDTAAFFNQGGIPQNLKSRVT
QNKILPDQLKVKSAVKKTGPGPHVITGPIYVEGAQPGDTLEIKTLAIDYRVPYGVISNRH
SRGALPGEYPLNNAPIYSRVIPLDTKREIGIFQPENNLPPIQLPLDPFMGIMGVVPANRE
EAANSVPPGNYGGNIDIKLLGRGSSLYLPVQVPGALFYAGDPHCAQANGEVALTAIECSL
TPTFELVLHKNMKLDTPMGETKDAWIAVGLDEDLDEAMKKSVREYLEIANSKYGMTKQDA
LLVGSAAIDFEVSQVVDIVKGIHGVVPKELFRDLKPQS
Download sequence
Identical sequences K9XD72
WP_015188438.1.9315 gi|434392778|ref|YP_007127725.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]