SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9XF05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9XF05
Domain Number 1 Region: 17-243
Classification Level Classification E-value
Superfamily Undecaprenyl diphosphate synthase 2.09e-91
Family Undecaprenyl diphosphate synthase 0.00000095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9XF05
Sequence length 249
Comment (tr|K9XF05|K9XF05_9CHRO) Isoprenyl transferase {ECO:0000256|HAMAP-Rule:MF_01139} KW=Complete proteome; Reference proteome OX=1173026 OS=Gloeocapsa sp. PCC 7428. GN=Glo7428_2709 OC=Chroococcaceae; Gloeocapsa.
Sequence
MTVKPIVLQDLPPDLKRERLPKHVAVIMDGNGRWAKHRGLPRIMGHKRGVDVLKDLLRCC
RDWGVAALTAYAFSTENWGRPLEEVDFLMTLFERVLRKELREMIEEDVRIQFVGNLSALP
RSLQAEIARAVAETQHNRGIQFTVATNYGGRQEILDACRAIAHQVQQGLLQPDDIDEALF
ERHLYTAGIGDPDLLIRTSGEMRISNFLLWQMAYAEIYITETLWPDFDRAEFHRALCSYQ
QRDRRFGKV
Download sequence
Identical sequences K9XF05
gi|434393423|ref|YP_007128370.1| WP_015189082.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]