SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9XK29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9XK29
Domain Number 1 Region: 117-294
Classification Level Classification E-value
Superfamily E set domains 2.75e-57
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000961
Further Details:      
 
Domain Number 2 Region: 29-145
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.5e-21
Family Voltage-gated potassium channels 0.0000495
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9XK29
Sequence length 295
Comment (tr|K9XK29|K9XK29_9CHRO) Ion transport 2 domain protein {ECO:0000313|EMBL:AFZ32980.1} KW=Complete proteome; Reference proteome OX=1173026 OS=Gloeocapsa sp. PCC 7428. GN=Glo7428_4542 OC=Chroococcaceae; Gloeocapsa.
Sequence
MTQKKRRSSRVVRIVNKDGRLNIVGSGKWYSYWRDPYHLLLTVPWTGFLAIVTLGYITAN
TFFALAYLVGGNGIANARPGNFFDAFFFSIQTMASIGYGAMYPQTLYANILVTIESLLGL
MGLAMGTGLAFARLSQPTARVIFSRVAVVDLYDGVPTLMFRTANKRRNQILEAELRVRLA
RDEVNAEGLSMRRVYDLPLVRSQNPSFALSWTAMHPIDESSPLYKATPEILAQQEASIII
TLIGIDETVSQTIHARHVYIARDILWNMRFVDIMLRTLDGDRHLDYSRFHDVTPL
Download sequence
Identical sequences K9XK29
gi|434395193|ref|YP_007130140.1| WP_015190847.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]