SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9XL98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9XL98
Domain Number 1 Region: 111-242
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 2.22e-40
Family Pentapeptide repeats 0.0000856
Further Details:      
 
Domain Number 2 Region: 7-160
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 2.49e-40
Family Pentapeptide repeats 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9XL98
Sequence length 249
Comment (tr|K9XL98|K9XL98_9CHRO) Pentapeptide repeat protein {ECO:0000313|EMBL:AFZ33283.1} KW=Complete proteome; Reference proteome OX=1173026 OS=Gloeocapsa sp. PCC 7428. GN=Glo7428_4855 OC=Chroococcaceae; Gloeocapsa.
Sequence
MDTDKLLTKYAAGERNFSGENLRSADLTRATLNAADLSEAILSEAILTQAELSEANLSRT
ILTKADLTEAVLAGAKLTGAILTEAELSRVNLYDAFMLGVNLTGANVTEGNLGGANLSQG
NLSGVNLSGANLAQANLKGANLTEANLSKADLTEADLSGADLSGATLSGVILSDANLSDA
ILSRAILTLAVLQGANLSGAVLSGVNLTEVNLEGANLSNAVLTSVNLTEVDLSQTNLSGA
TMPDGSTYE
Download sequence
Identical sequences K9XL98
WP_015191150.1.9315 gi|434395496|ref|YP_007130443.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]