SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9Y8R4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9Y8R4
Domain Number 1 Region: 124-318,416-564
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.36e-106
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000103
Further Details:      
 
Domain Number 2 Region: 296-429
Classification Level Classification E-value
Superfamily GAD domain-like 8.83e-34
Family GAD domain 0.001
Further Details:      
 
Domain Number 3 Region: 1-104
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.43e-32
Family Anticodon-binding domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9Y8R4
Sequence length 596
Comment (tr|K9Y8R4|K9Y8R4_HALP7) Non-discriminating aspartyl-tRNA synthetase {ECO:0000256|HAMAP-Rule:MF_00044} KW=Complete proteome; Reference proteome OX=65093 OS=Halothece sp. (strain PCC 7418) (Synechococcus sp. (strain PCC 7418)). GN=PCC7418_1130 OC=Aphanothecaceae; Halothece cluster; Halothece.
Sequence
MRTYYCGDLKAKQIGETVTLYGWVDRRRDHGGVIFLDVRDRAGIVQVVSDPERTPDSYPQ
AENIRNEYVVKVTGRVSQRPEESLNPNLPTGEVEVYADEIEVLNAVRKQLPFQISSDEAD
AVRENIRLKYRYLDLRRERLNQNLHLRHQVVKAIRRFLEDEENFAEVETPILTRSTPEGA
RDYLVPSRVNPGQWFALPQSPQLFKQLLMVSGFDRYYQIARCFRDEDLRADRQPEFTQLD
LEMSFLSEDEILDLNERLVCHIFKTVKGIDLPRPFPRLTYNEAMSRYGSDRPDTRFGLEL
VDVSDIVADSGFKVFSGAVKSGGLVKVLPIPGGNDQISNVRIKSGGDLFKQAATAGAKGL
AYVRVREGMEIDSIGAIKDNLSEEQKQELLRRTGAQPGHLLLFGAGDTVTVNKSLDRVRQ
ALGEEMGLIDENAINLLWVTEFPMFEWNPDEKRLEALHHPFTAPHPDDLEDIKTARAQAY
DLVYNGLEIGGGSLRIYQREIQQQVFAAIGLSPEAAEEKFGFLLEAFDYGTPPHGGIAYG
LDRLVMLLAGEESIRDVIAFPKTQQASCLLTEAPSAVDEKQLKELYVASTYDPEME
Download sequence
Identical sequences K9Y8R4
gi|428775763|ref|YP_007167550.1| WP_015225213.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]