SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9Y8W9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9Y8W9
Domain Number 1 Region: 2-76
Classification Level Classification E-value
Superfamily L28p-like 2.16e-25
Family Ribosomal protein L28 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9Y8W9
Sequence length 78
Comment (tr|K9Y8W9|K9Y8W9_HALP7) 50S ribosomal protein L28 {ECO:0000256|HAMAP-Rule:MF_00373} KW=Complete proteome; Reference proteome OX=65093 OS=Halothece sp. (strain PCC 7418) (Synechococcus sp. (strain PCC 7418)). GN=PCC7418_0302 OC=Aphanothecaceae; Halothece cluster; Halothece.
Sequence
MSRRCQLTGKKANNAFAISHSHRRTKKLQNVNLQTKRVWWPEGNRWVKLTLSTKAIKTLQ
KKGLQKMADEMGINLNQA
Download sequence
Identical sequences K9Y8W9
WP_015224416.1.10129 gi|428774965|ref|YP_007166752.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]