SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9YAA8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K9YAA8
Domain Number - Region: 7-89
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0196
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9YAA8
Sequence length 101
Comment (tr|K9YAA8|K9YAA8_HALP7) Uncharacterized protein {ECO:0000313|EMBL:AFZ43891.1} KW=Complete proteome; Reference proteome OX=65093 OS=Halothece sp. (strain PCC 7418) (Synechococcus sp. (strain PCC 7418)). GN=PCC7418_1722 OC=Aphanothecaceae; Halothece cluster; Halothece.
Sequence
MRFNNRYLRQIHRWFAPIMVFPMLLTLLTGSLFQVAVLTGESEKFLWLLDIHRGKFGTLD
LTWLYPFLNAFGVLILLVTGIIVWLQVPFPKKKANSQNNSN
Download sequence
Identical sequences K9YAA8
gi|428776318|ref|YP_007168105.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]