SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9YAQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K9YAQ4
Domain Number - Region: 341-370
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.033
Family Rubredoxin 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9YAQ4
Sequence length 434
Comment (tr|K9YAQ4|K9YAQ4_HALP7) Transposase, IS605 OrfB family {ECO:0000313|EMBL:AFZ43485.1} KW=Complete proteome; Reference proteome OX=65093 OS=Halothece sp. (strain PCC 7418) (Synechococcus sp. (strain PCC 7418)). GN=PCC7418_1286 OC=Aphanothecaceae; Halothece cluster; Halothece.
Sequence
MLRAIKVRLYPTPSQQSQLNQVMGCARYWWNYALALCKQHYKDTGKGLGRTALNAYLPLL
KRQEETAFLKECPAQVLQATTLNLTKAYKNFFEGRARYPRFKSFDQRQSCQFPQHVKIVD
NKALRLPKMEGLVKAKIHRLFEDGKLKTVTISRTPTGKYYASLLFETQQEKPTPVTEGKV
AGIDLGIKEFALVHDGEKCSKFPNPKHLSKHEKNLKRKQKKLARKQKGSQSRNKARKLVA
KVHERVSNTRQDYLHKVSRKIVDNNQVVVVENPSVHLNSIQVLADGRIPRLNIKGMVRNH
KLAKAISDVSWGMFVNFLDYKLKEKGGFLVEIDRWFPSSKLCSNCHYELESLDLEVREWT
CPKCGTHHDRDENASKNIRAEGIRMLSVSGTGTAAVGGDRSPKLGRKVKFGHSPTNIEAP
TCVHRGWGSSQFPH
Download sequence
Identical sequences K9YAQ4
WP_015225361.1.10129 gi|428775912|ref|YP_007167699.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]