SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9YDJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9YDJ7
Domain Number 1 Region: 15-499
Classification Level Classification E-value
Superfamily ADC synthase 9.81e-155
Family ADC synthase 0.000000261
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9YDJ7
Sequence length 503
Comment (tr|K9YDJ7|K9YDJ7_HALP7) Anthranilate synthase component 1 {ECO:0000256|RuleBase:RU364045} KW=Complete proteome; Reference proteome OX=65093 OS=Halothece sp. (strain PCC 7418) (Synechococcus sp. (strain PCC 7418)). GN=PCC7418_2325 OC=Aphanothecaceae; Halothece cluster; Halothece.
Sequence
MIEFSQFCELANQGNFIPVYEEWTADLETPVSAWFKVCAGQPYSFLLESVEGGENLGRYS
FLGCDPMWVLENRGESTKQVDRAGKETVYQGNPFTVLKECLASIHPVKLDNLPPGIGGLF
GMWGYELINWIEPRVPVHSRQEEDLPDGVWMQVDQLLVFDQVKRKIFAIAYADLREKQDL
QTAYQEARDRVTTLVSKLQSPLPKIANTVSLSSSPTTDDSTYESTTTQADFEASVEKAKD
YIHAGDIFQVVLSQRLNTAYTGHPFNLYRSLRIVNPSPYMAYYQFGDWQLIGSSPEVMVK
VELTSDHKQQATLRPIAGTRKRGQTPAEDNALAEDLLQDRKELAEHIMLVDLGRNDLGRV
CEKGSVTVDQLMTIERYSHVMHIVSNVIGEVADQQTAWEVLKATFPAGTVSGAPKIRAME
IIAELEPHRRGPYSGVYGYYDFEGQLNSAIAIRTMIVRPESEDKHKVSVQAGAGVVADSI
PQKEYEETLNKAKALLEAIRSLQ
Download sequence
Identical sequences K9YDJ7
WP_015226350.1.10129 gi|428776902|ref|YP_007168689.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]