SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9YUB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9YUB3
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.51e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.0081
Further Details:      
 
Domain Number 2 Region: 75-117,149-202
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000469
Family Glutathione S-transferase (GST), C-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9YUB3
Sequence length 266
Comment (tr|K9YUB3|K9YUB3_DACSA) Glutathione S-transferase {ECO:0000313|EMBL:AFZ50097.1} KW=Complete proteome OX=13035 OS=Dactylococcopsis salina PCC 8305. GN=Dacsa_1405 OC=Dactylococcopsis.
Sequence
MLELYQFELSQYSEKVRFLLDYKGLEYRKIEVTPGMGQVEVYQMSGQRQVPVLKDGETVI
PDSTDIAMYLERNYPERPLLPTASREKGLTLLMEEWADESIGLKSRKAFIGALNRNEALR
TAVLPSDTPDFVKSIVSGIPSDLLDALGTGVGIGGEALKAIEGSLKQDLEALCLILQEQP
YLTGATPTLADFSVASLSLLLKFPEKSYMDIPDQLAGKALPGIGDNPAFEPFFSWRDRLY
SEYRQATVSTTTSSSSGNAPSSIEIE
Download sequence
Identical sequences A0A2K3BFE3 K9YUB3
WP_015229101.1.8022 gi|428779668|ref|YP_007171454.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]