SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9YUP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9YUP1
Domain Number 1 Region: 210-433
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.000000000000706
Family DPP6 N-terminal domain-like 0.016
Further Details:      
 
Domain Number 2 Region: 92-248
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.0000412
Family DPP6 N-terminal domain-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9YUP1
Sequence length 496
Comment (tr|K9YUP1|K9YUP1_DACSA) Uncharacterized protein {ECO:0000313|EMBL:AFZ50070.1} KW=Complete proteome OX=13035 OS=Dactylococcopsis salina PCC 8305. GN=Dacsa_1376 OC=Dactylococcopsis.
Sequence
MAISHKLKPIDRAAITVIILLSFVLMGLLLSEKVCGTDCWFKAKANVREFSWEGQKISAE
DRGFILNFSRPMNRESVENNLKIEPQLPGKISWSGKRMAYTLDNPAPYGTEYKISILGAK
ETLGSEIKPFQETFRTRDRAFVYIGVNGEEKGRLILYNLTQQEKTILTPPRLVVNRFFSY
PDRSKILFGGTSRENWEQGKLDQKLYTVTTGINKTENPSGKIELILDNKTYQILEFELSP
DGEKIVVRRGKKEASGLGEISLWVIENQASPQKLETATGGDFIIPPDSKTVAIAQGQGVA
LISLEKDSNPSNFLPQYGQVLTFSPDGTAAAMVNFNTQDTEKQYIRSLYLVTNRNVEKNL
LNTNGSILSCEFNPTVTHIYCLLTELIEGEQYQEKPYLVSINLETAAVTPLLTLPEYRDV
KMSLSPDGLALLFDQIMTVRETSETTVKTLRSDSGEAIIGSRLWLLVPTPTLTKDPNQKP
QLEELPISGLSPFWLP
Download sequence
Identical sequences K9YUP1
WP_015229075.1.8022 gi|428779641|ref|YP_007171427.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]