SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9YVJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9YVJ7
Domain Number 1 Region: 1-213
Classification Level Classification E-value
Superfamily HAD-like 1.23e-45
Family beta-Phosphoglucomutase-like 0.0000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9YVJ7
Sequence length 218
Comment (tr|K9YVJ7|K9YVJ7_DACSA) Haloacid dehalogenase superfamily protein, subfamily IA, variant 3 with third motif having DD or ED {ECO:0000313|EMBL:AFZ50542.1} KW=Complete proteome OX=13035 OS=Dactylococcopsis salina PCC 8305. GN=Dacsa_1888 OC=Dactylococcopsis.
Sequence
MLQAIIFDMDGLLIDSEPFWQQAEIEIFAKVGLNLTSKLCEQTMGLRIDEVVNYWYQRHP
WEEPSQEEIAQQIVKRVVELIETQGVAKTGVYPLFECLEETNLPLALASSSDYVLIEAVI
KRLNLQDKFTVMQSATAEKYGKPHPAVYLSTAEKLGVRATNCLALEDSFNGVLAAKAARM
ICFAIPEGYPQPDPRFVIADQMFPSLLEAKTALIELIN
Download sequence
Identical sequences K9YVJ7
WP_015229539.1.8022 gi|428780113|ref|YP_007171899.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]