SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9YW96 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9YW96
Domain Number 1 Region: 5-190
Classification Level Classification E-value
Superfamily CheY-like 5.27e-46
Family CheY-related 0.0000843
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9YW96
Sequence length 244
Comment (tr|K9YW96|K9YW96_DACSA) Response regulator with CheY-like receiver domain and winged-helix DNA-binding domain {ECO:0000313|EMBL:AFZ50393.1} KW=Complete proteome OX=13035 OS=Dactylococcopsis salina PCC 8305. GN=Dacsa_1729 OC=Dactylococcopsis.
Sequence
MENHKEKILVVDDEASIRRILETRLSMIGYDVVTAADGEEAITTFNENNPDLVVLDVMMP
KLDGYGVCQELRKESDIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVL
RRVDKEGLSGIPSSGVIQIGSIRIDTNRRQVYKGDERIRLTGMEFSLLELMVGRSGEAFS
RSGILQEVWGYTPERHVDTRVVDVHISRLRAKLEDDPSNPELILTARGTGYMFQRVTEIG
EEKS
Download sequence
Identical sequences K9YW96
gi|428779964|ref|YP_007171750.1| WP_015229390.1.8022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]