SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9YWB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9YWB8
Domain Number 1 Region: 7743-7945
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-38
Family Leech intramolecular trans-sialidase, N-terminal domain 0.037
Further Details:      
 
Domain Number 2 Region: 8783-8949
Classification Level Classification E-value
Superfamily Anthrax protective antigen 8.76e-21
Family Anthrax protective antigen 0.0037
Further Details:      
 
Domain Number 3 Region: 8330-8532
Classification Level Classification E-value
Superfamily Anthrax protective antigen 1.44e-20
Family Anthrax protective antigen 0.0037
Further Details:      
 
Domain Number 4 Region: 9197-9366
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.000000471
Family Galactose oxidase, central domain 0.023
Further Details:      
 
Domain Number 5 Region: 9813-9882
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.00000105
Family Crystallins/Ca-binding development proteins 0.01
Further Details:      
 
Domain Number 6 Region: 10454-10495,10555-10744
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.00000204
Family DPP6 N-terminal domain-like 0.042
Further Details:      
 
Weak hits

Sequence:  K9YWB8
Domain Number - Region: 10399-10530
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00123
Family Galactose oxidase, central domain 0.047
Further Details:      
 
Domain Number - Region: 9609-9752,9906-9941
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00204
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.037
Further Details:      
 
Domain Number - Region: 9339-9591,9646-9695
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0248
Family Galactose oxidase, central domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9YWB8
Sequence length 11106
Comment (tr|K9YWB8|K9YWB8_DACSA) PA14 domain-containing protein {ECO:0000313|EMBL:AFZ51211.1} KW=Complete proteome OX=13035 OS=Dactylococcopsis salina PCC 8305. GN=Dacsa_2625 OC=Dactylococcopsis.
Sequence
MPLEIPVSEVSFSSPLTQDLDDPNSPSKKSSALEKWDSEKLIPLDNSASGIVFVDSTVSN
ADSLLANLEADTEVIYLDSQEDGVEQIAQVLGARNNITGVHILSHGDVGTVQLGNTALSA
ETLSAKEETLQQWGNGLSPNGDILFYGCNVADDSGEGFIQQISTLTGADVAASNDLTGND
GDWELEAVIGEIETDIAFTEESQAAYTSSLFLTDQVQLDTEEKQINFQTGKREANDDELY
LSVNENDLLTYSFDNSNFITDFNSEQGQQNLSISKFQEENYQIKASFGLGDDTLSIDASL
AEALNNGSAVTKWNINAIDAGSIDAGDKTNIIQFSGAENLLGGSGEDQFNLATNGVVNGK
IDGGDNSNNDSLTYENYDGAVTVNFGLNRATGVSEFANLNNFVGSRVTINPELSTASTPT
AIKSADRVQVGDRIYEAQTDIAPALGLDVDYTLEDSPNLIALGDRVQTENGKIYQAVAVI
EPNSGTVDLSQQDYSNPSKWFEITVDLSDDQQNYENNENWQEITNRVIGDDVDTNWQIVG
EDEIAVNGFSLSNFSDISGGLGEDTITFQDNSRLTGEIDGQEQGIFDYTTNSASPQVIPT
GSRVLLDDGRIFEATQPIGFPPLGNNQTQYETTDTPQIIKAGDRVQVGNNLYQASEGITP
DDSGSVNLTAENQDYFNNESWERLTISLADQDYENSDNWEEVIITGDTIDFSNYNTAIVA
NLEKQTIINNSTDQPLTSFRNIEQITATDSDDDQLIGPQENTQWRLTANDRGTVTGIKFN
NFTRLKGSDDNRDWFVFDTFNHEFNGTINLDGGANGVDQFATLDDNKNYVPANQSGKGTT
DEIVSGLTINYQGLDAFQTASSNGNTLNITGTPLADELTLANESGNLEIRLGNRVTTPDL
SNVSEIAIDLGGGNDEITIATAGFTFNQDLTLKAGLGSDEIKITENLFLNQKNLSLDGET
ITVDPNVTLSTQSQGQAGNISLTGKTITLADGVSLEAKADNISNSGNIKISAAESEVLSP
VNNSPVIFSRKTATVAIGEGVNIFGGKIDITATANDKGFLAALGASSLANNFLIAPLTKK
LSGLADLGLPVKVVQKSSTADIDIGDGTNIKGDGYVTIKAKAVTNSSGKATNKLVSVGYT
NAQPTADITFREDNDDATRTTVEAGGPLLVHADGKAVSKITTKTNKKLGEPSLAETALSL
AVSNSDLTSQVTVPANVTMTAGKTANILATGDNATDASATSGLFANGLAGMAFGLGFSDA
EVKAAVDGQITANQESGAVVKMEFDPTEDGVIDFDRNTINMAKALGNETPRVIAHALKTG
DKVNYSNRRGNSIGGLTDEKDYFAVVDPNNPNEIYLAPSLAKAREAGSKLQAGETPQVIS
LTNPVSQLTGEVVDLAAKDFSIAKDFGITDIALNTKTFDPESAIEDSAINLDNSGGVEDL
VTSLDYSVSDFAIHGSTFELGQAVRYSKGDESNTAIGGLEDGQNYYVVASTNEKNLEGDK
RFVTEQTIKLAETENKAHAGVFIELDPSVATGDNHSLRALHVLDTGLVTGLGVVADLESS
NDVASEAGLEEQEEQSFDPNQKTSKLDKTRNVINTSVGNRLFQVLTEAFSESTATERAEK
QTGSNSKLSLAGSLAFLNTDHKSLALVGELDDEGKDFDEAFDGVENETDTAQAKLQSKED
LEVTADITESMSLSAESSNEPQDGDKIKTENADTKNPQIAGSAAVLVNLQNNQAKAIIDP
QAQLDAHRALRVTSDVSYPYLTRPDEIIPWTSGEFLDQFKDEGPDALLRYLDFGSELQSI
FNTWARSTAKADDGKDAIAGAVNFLDFDNNSLAIVREGAKLNQDTDFRNPAGNETVSVEA
TNYMQMLNVTGLFDFGLPSLNLDVLSLEAEGDKGSLGFSGSSDQRGGYGGALYIQSLENT
TLAFIESGASIYTGGLGGVNMKAEEAILNLGFVQSGAVAGSFGVGGSVAYSYQESNTLAH
LASGAIVTSGRINDESVSDEKDVTGSPLTIYAGSLETNINWVGGVAKGRNLGFGISVGIN
DITRNTRAIIGEEADESVSDETSTLDITGDINVKGKVDGGIYAFVAAAAAAGDLTEPDDN
TEGNTSESDVEGKDGEGFDYGVGVSANASVNLVEDNVVASIYDAGNLNAQNVNVLGLNQT
DLWVLAAAFSATLPSKKAEEDEQNTATIAGSFSFNQLKGETLAYIQGKNGDRSLKTAIAG
DTAITAERKGMIRGATVGFGVKTQEKDGNSLGLAGSVAINELSNRTDAYVANVADLAGDT
YSLTITAQDKTSIFAIAGALSIGDGGNNAGVGFSFASNRIDSDVTATIENSLLDQLQTVQ
VITRNEAEIIAFTTSGALATSEENDSQLAAVGAVAINTITGQGKASIVDNSTVTSQGDVR
VKAFDLASIKAVAGGAALAASLGKASAEEAKTSQNSGRAAAGAALAINNIGKTRDLEFNA
GGDVDVNADTFSFGESHGLETGDAVTYNAGEESVALAFDANDAIDPGNNTIDFGTAHNLV
TGQKVAYNSGDETTIGGLTDGAYYVIVTDQQSIQLATSAESAKAGDAIDLTATGSGEQLI
TPDRLAVAGLEENQNYYVIKTSDTTLQLATSEEKAQAGDAIDLTREGAGTHSLTVATEAQ
TSRAEISNAQVTATQGNVTVEADSILDETIAFNPRDQLVKPVLAFDAGEGTVDLDANVIT
IAQHGLETGQEVVYVGNGGSDSEDSGNIGGLASLETYHVVKIDADTLALAKSVEDANNDN
YIDLTSYGDGLVAHELQFVQSSPVNVNNDTLYLENHGLITGQKIGYDKGDGTAIGGLEDN
QDYYAIVLDDNVIQLATSEEAAKQGQAIDLTSLGDGESHSFSYGRLASIASLTLGGAVAG
GEGQGGTGFSVSGAGAGSYNAIYKSITAVITDEATVEAGNGDVRVTASDHSRIVASAGGV
GLALQVGKNENAIAASVGASVAANVISNDLVANVTKATVSASQELIVTADSEAEIYSLAV
GGALSAAKGQNALSLSGAGSAAYNAIANTVEASILDGATVNAGQGITLTASDRSRILTGS
GAAAAALAIPASGKQGVSGAVGVSISVNDVDNRVRSIIAGEGTTVTSNAGEIELSSESTA
QIDAFTYAGAAVGGTLAGVASGASSFNRINNTITASLEKQATVNAGNSVSVTATDDAAIH
AFVGGGALGIAGGKGDKFSGTIALAGALAINTVDNKTHATIENGTISAATEENPIDLNVA
ARSTGSITTVSTAISIAITAAKDKGLAISGAGAGANNVILSTTEAFITDSTLTPDDINHL
NLTAENQAKISGNVVAVSGSGAGGGSAAVGASLARNLIGWESDFTKSPATVKAYIRNTAV
KITGALSLEAIAEEDIEARVGAGAVAVAGGKSGGLGLSGSGVLTENRVNTEIEAFITGNE
NISIEADAISLNAEETPYINAQAGAASVGFAPGKAGATLSLGGTLAINDISNQVLAYVSD
VAQLTSTSGDITLSADTSNKGVGNLPTEFNPNLLDRVAREDDLGTRQTLRQELTNIGVDL
APTSHGYQSSDGEVEGLLPNARVKHEGTVYAYQGEEVEGTIDLSNQAQDYANSDQWQVVD
DLEVSILDAGSEWSVFDGETTYILKQENGEIEAYRSGINAVSVAASIGAGFGNKAGVAIS
GAGASANNTITTKTNAYLDRVTTVNSANNVSVEATNTTGITARIAGASAAIGIGSKAGVG
ASIGVGLARNVIGQSLLSDLTQGEDYDYVLGQGEQEITIKQGDKVYIPDGIRGGEVYEFI
GENEDGETIDLSTTDYGNRDAWRLANSQANAMEVRAYIQDADVTATGNVGLKAVTENSID
AGVGAGSIAIAGGKGGVGLSGAGAAAENTINTDVQAAIEGNAETGVTARGITLQAQDISA
IKADVAAASIGGAFGGTGVAITLGASLAYNQIDNTVEAFFKDIGKGVTATNGAIFIASEQ
GATIEAKTIALSFGASAGKVGVTISGAGAIANNVILSDTKAYAENSDLEAQLINVNANSI
GEINAVVVAVAGAGAAGKVGVAGAIGSSVARNLIGWESDFSQSPAQVQAYLKNSNVDADS
NLSLSAIAEESIKARVGAGAVAVAGGMVGVSVSGSGVLTENKVNSDIKAFITGNEENTIE
ARRISVVADETATITADAGAASIAGAVGKVGASVSIGASLAFNDIRNTVEAYISDLASVT
TSSGDINVLATSQGRELETIDAETLAGEDDNLRKTLRDALFDKDFNRLRDALTGEDEAAD
LSFRKTLRQALTDAGIDLVETRYGYESSEGKVPYLLEKARVKDDGKVYEYQGEAPFDYTS
ADGTQTIVSGDQVLVDNGEEITLYRYNPPQSGSSQEIDLAQEDYAQSSVWEKVEIDPIDL
RNQDYTNSDQWQEVDDLEVTALKAGEEWSVFDGENSYILKRNGEDVKVYRTAIESVSVAA
SVALGAGLAGVGISGAGAASNNTVNTKTNAYLENVEQVTSAGDVNVKATNSAGIVSRVAS
ASAAIGVGVKAGIGGSLGVAAARNVIGQSLVSSLIENENYDHTLTDGEKEVKPGETVYIP
EGIRGGEIYEYVGETDTLDLGNADYGNPELWRIANRESSPMEVRADIQDANVLAEGDLTL
EANLETSIDAGVGAGSIVLTGGAVALGLSGAGGAAENTIATDVKATLAGDDQQAITANSI
NLEATDTSSIKSTVAVLSLVGSFGVFAGGATLGASVAYNQVDNTVEASITGQKVTATEGD
IRLISEQEGSITGNTVAVSAGLSLGKISANLRGAGAIATNITLSDTEGFAKDSQLMSNNG
AVTLIANSNATIDATVVGVSAGLGGGLVGLSGGIGSTIARNLIGWEVALTKAPAKVRAYL
DNTSVTASDDLTLTATASNRVISSVGSGAVSLAAGAGGFSGSASGVTTENRVNSHIKAFI
SGQDQATIEAQAIEITAEETPSVKSEAGAAALAASFGKIAGGASFAGTLAINDVSNEVNA
YVENVAGLTTTADRINVTATSQGKKLGTLQTDLNADDFETAATEETLQLRQEIRNALTAA
GLELASTSYTYEASEGTVENLLAGTRVKKGDRVYTYVAGPNYDHRSFDGEKTVKNGEKVY
VPNGRSGKIYQYTGQEDTLDLSAIDYSENKAWQPVSTQPIDLNAEDYDNSQRWQEVDDLK
VKTLEDGSKWSVFDGETTYIVELTDGEFQVGESAIDAVAVSASLAAGLATLFSPTPAALA
TGVAVLSGAGVATNNTITTATNAYISQSTVDSAKNLNVNAFNNAEIISTATASAGVAGVA
IGTVSVGGAFAGAVARNVIGSPLLSDLITDGLTGSEPLVEGEDYQHTSNDGKQTLTPFQD
RVLITDGVRKGEVYSYVGEEEVEIDLANTNYGNRDLWQLVAQEQESTDMEVKAYIEDSQV
TVTDDLKVKAVMANSIDAGIGAGSFAINGALAAANFSGAGATAENTIAAQVEASLDGNSE
TTVSADNITVEAQDTAAIKADVVTPVVGAAVGVAGGSVSIGASFAYNQINNQVEAKITNA
KAITARQNLRINSEQAATIQASAIAVSVGLAGGGVNLSIRGAGAIANNFILSDVKAYAEN
SDLTANQLQITADSRNQINATVSASSGALGIGGGAGTAALGASVARNFIGSGSTGGFFTQ
PDSAAVKAYLNQTSVDVDGVLTINSNAEHNIDALVITPSVAVTAGLAAGLGVSGAGAITE
NKINSEIEAFINGGKSISASTVTITADDNSTINAKTSAVSVSFVASVAASVAVAVGAAIA
NNEINNAINAYIANAEVTTQVGDVTLQAKETATINALTFSAGAAVSLASSGIAPATAVTN
AVNQLNNKVNTYLAASTIEAAGAVTLSADDTSKVDAETKAFAGSGGVFSLAAGVVLAQNE
IGNDTTAYIANSTVTAGNGISVTATANPTLDTVSQVGAIAIGLGASGTGGRAETIINGTT
LAYVDGSNLTATGNNIIVNANATTNANPKLQSLSVGLVGITVMKSFADIGGATRAYLTGT
SSVEAQKLDIQATDTVNAEPVTEVGAGGAITITKNFSTIDVTRETEADVRAGGDLTLTQG
ILNVKATSDVSGIAKTLSNTVSPKVNIGNLTVKTTLDNTTRAQIEAGATVRSNQEAVNVI
ANATNTAEASIESLGVGLVLAVSDSEPTAKVKSTTEALAQGIITGIGENGKVGNVVIEAT
ATDQATAGAKTKGGGQISVSDADVKAEVTSSLNALGGGTIESANNVQIGATGNTDADADA
ESSSGGVVEVSNLEAIATSNPTINADIGLDATLEAGQDIIINAVHGEDSPTFSDGSFDAS
SAVNQSANTITFNDKHGLLTGDTVTYNQNGQSNPVGGLTDGREYGIIQSSDRALKLGVTV
NSLDSEDNPLIDINRDTIHFTAKHNLEDGDRVIYTPEKAVIGGLSSGSTYEVNKIDDNTI
KLIDPNNPPAAPETFSGSNITSNTITLTNHGFSDGQTVTYRAPKGSEFSSPSVDVTGTGD
NPLAEADNNNIYLGSGHGFQSGDEVIYRSEGNTIGGLQNGERYFVIFDTAKPEQIQLAET
YEKAVGVNDDNGTPDDPSDDTVIPITPIELNPDKSPEQETVIHSLLKVSDQPIGGLTDGL
TYYVDRVNNNEFRLQDNNGNTINLDGTDPEDSSVTLTGNNTLATEGIDLTNPGSGSHELV
LDITSQGSNTQRLEGIGGARALLSAPSGDGVVTASASGSNGGVVRVAEAKTTATANPTIN
IEIGDRATLSANNIDVDATAKGNIAASSAQSGGGLVSVGDAQATGNLNTVSDLTIGEKAT
LQATNDITLNTTTQQDTKVLAESKGGGAFDFADADITANLDYSSTIDIGDRSELEAENLL
EVDANSQVEINADAETDSGGLGAFADTGADVKIGNSSKDRAKTTTTIGSQARLQADTLTL
LAETTKQDALVKAESDAGGAGADAEATANLDIFDNVQVSLEDNAGITGTTVNIQARHSGV
NIRSDANADTDALYGDADAKARTDYDSNNAVNFAQGATIATGDLNVTSTQTVDEYSRSAG
ADKDIFGSESELETGNFNAGRTINWNGDVVFLSSEAARLKVSGTGDLVKAENVTAKVSDE
AVTVDPIINQTPVSNANFTIGETKANGKTAPEGVITGDKGKFSASASLFPKVELINESDR
DFIINDITLAKVNQPQITIDAPKNELNFAVEDRIQDLLEQGITVTVTNDGSGDVRFQRLL
NHPIGAIEVNNTNGNIETSDQGILRGNEITLNTDKGGVGNEKNPFAVELVRSNGKQTDLD
VNAQNEIWLDVKGRLRETNVESAEFEGSKIETPADVNLSFQPSVQETKATGGFQGVKVIT
GENEETIERSYPKDENQNNQSGLNLGLFAETKQAQSISSGFNLEQIKGQNINLEAIQDTR
IDLTANTDHAKDGDIEASFTKGDITLTETNGDFLLKNIRSRIGNIDLTAAEGNAEAVTVE
TDTGNINLLASETVNANLIRSTNAGDISVTANDGNVEAVTVETDTGNINLLASETVNANL
IRSTNAGDISVTANDGNVEVVLIKTNAGDVNLSAGGNTGAIFETNSPENGDNGATPFVIG
DNITLNATAGIGTPDDFLEMDSSVASNGEVNAEANDSIFLTETTGDLRLGGIVSNNADIS
LLTEDGSIRDGEDDPEADLQASKLDLIVNGGGIGNSNNKIEIYGAGNGQTQNSELQLSTA
TPEPGRLYTVATNDIYLQQVNGALDVMGVTSKEGRVNLSVLDGAQGETENFRLLPEGDVP
LTETEDLIATYNFERNANDQTGNGNDGQLTNGAEITQNGVKLDGNDDYVNLGTPDNLVLE
DSFTIEAWIKPDANFQTNRFGEGGILINKEGEYEIARFADGTIRWAFSNRSPGWTWINTG
YVAPAETWTQISVTYDQGTIKTYANGDLVHTYNGSGNITDVSSQDEVRIGGRQGGAPQYF
TGLIDSVRIWDSVRTQEQIKNHYQGRITAADDVEINVGDDIELPATTLIEAKGGTATATL
RGDFNSQDENIGSTFTIIGDVQATDEVIFSGGEDIDHLQLLGTKGVNANGNTRLKGGDSD
DRFYVQGTSSSLTLQGQTGADRYYFGTNASKALFSPNGVFNDDNALAVLNGDLSAIDADV
TVATGVGGNRSTRDVVYVKGQGGNSGQITASQNAEAIVSGFSNMTGSVKLQVPDGGKNSS
FLKIGLGDNNNQFRVKGLGAQAIAEIYGQGGDDTFNIGDTNNALDKINGVVAVYGENGKD
TLNVFGDGSKTGDDPNQLTAIGVTGLGMGTNALLSTHNRFGAGYDIGLNQYPGAIYYGER
DQNRNTSGINYRFYQGDFKRVADLTEDHLQEEGNLTAKELSKVGGLSQQLGEQKDKDDDR
FGLVYEGFINVPESGEYTFYTRSDAGSTLSIDGELVVDNDGLHGRDTKDGTIELAAGYHP
ITVKYFENGGGELLKVEWEGPNIERQTLSPQSLSQSINNTFQPEVETVNINLGENADRFT
VDSTSDNVETNINGGAGDTIIVNSTDTGLEPNQLDRVDFIRGEVNLSGETLILNDAGDDN
ANTGIYRNGTVEGLDMPGRLTFSNANTVEIRLGLQQDTFYVPETNAGLDTTLKTGGGFDT
VYVGTEAGQENEGSLANIKGKFTVDGGGPAARDILYLNDQNNNNGKTYTVSNEITGIKSL
VSGDAWPVDTTTVKREDTAAIDYLNVENFVLNAGGAKDTIDIQGTHREQDVKGGKGSNFI
VNAGLGEDLIQVGEPVGNGERSLENFAIDLANPMANISGVNYRFYQGNFKRVADLTEDHL
QEEGNLTAKELSKVGGLTQRLGQDKDKDNERYGLIYEGFINVPESGEYTFYTRSDDGSTL
AIDGELVVNNDGLHGAETKFGSIDLEAGYHPITVKFFENGGSDTLSVEWDGPNFDRETID
PNDLFNPSSHTGKGIPVMIDGENGEDTIQVLNNANDTNTSVSASNVGFADLFPVNEDAKE
DDDTNNDGISDRSFNLYNSVFGENPTFSNYGRVALTEEGQRNPININARNNEAVRVSLGK
GDDTIEAGNSNRPLDYDFTVDGGDGDESFGIDNVAVTLSPSITFNGQGGDDLVFANFAEG
VPTTAPLDFTFNGGTSDQEGDKFRLSGDGEIKDGQYVPSATVDRTGEVSLADHQFNLTNV
EPIVVHGFPDFQVVTPKNAPSDLSLDATTVGDLEVSQVDRQIVTVDGVVSWNQEDQLEIK
ELPEPRYLSGAVANETLESSAMAVDGDTLVVGAQLDGVDYGAAYVYQWQNDAWQQIMELT
PRDKEEAGQGFGEAVAIEGNWIIVGAPSDNVNGTNAGAAYLFRKGDGGWQQVQKLTPNNA
NANDAFGTAVDIDGLSAVVGAPGTGNNDNNDTAYIFAETQQWNQTASWTDANTDLGRAVA
IDGNDVVIGLPEANEARVYNRPRRRNANWSLQDTLTPSEPDQGEAFGHTVALDSDRIVVG
APLWDGENIGQGRAFVFDRAGDWTRSARLTADGGLPAAEAASEGRAGDRFGFSVAVDGDY
VTVGAPGYDANATDVGAAYVFREIADQGSLNGSTWVRSTGATGSGRLMAQSPAGGDPGDA
PLPDHFGGAVAITGNRLIVGMPGFNDVNDNNQIIRPDVGAFRTFITDDKLPPVTNPSLQA
ETLDITGSEIHYDQGTKTLFVADENSNRVISYVNEGLSWRPANTFTGGSGFGADIDSDGS
CLVIGAPGENRVYTYTFDGNDWDNNRSILDGGNYGYGLFGSSVAIDGSNLAVGAPNAQLN
YYSTNRADNNHEINLGNTGVVYSFDLNENNNSWQRDRVLMPYRNNMPEKTSRREKKVDEG
WFLDNPGKGYESIGSNRNYIQIWEDEFSDDNDIFAKGQIPDLEYRSESNDDYSSIEVHRG
MKLVVYQHNNYRGYRYSFAGYTRLAFNGRWEFWDDQISSIKVYERYRKVAYPIERESYDQ
LDNSKWGAELDISGDRVFVGAPGEDAVAVYDVNDNDKDNWRVRVAGNQAIKPTLPFDLND
ERGSDLGSAVAAYNQNLFYGGKPTAKDNVYTYDLQKDKQGSVKDTLYDSGLRQSKGFGET
ITISGEEMLISNPLKDNEAGTVYLTDAKSGEYKGLTLKPYRQQARQEGSKETFEISDGSG
WTTATSDSNGHFSNFLGRFGQGQRTSKTFDLDGKAATIDFDFYRIDSWDNENFRVYLDDE
IIIDQRFTLRKEYTEVITGTKNGISWTITPQNDYGQRAFRGWEDQSFQISLRIPEGKEEV
KLGFGSILDEEVNNESFGIDNVAVRSEGELKYQETFEVSDGSGWSTPASDGNDHFSNFLG
RFGEGQRTSKTFDLDNKAATINFDFYRIDSWDNENFRVYLDDEIIIDQRFTLRKEYTEVI
TGTKNGISWTITPQNDYGQRAFRGWEDQSFQISLRIPEGKEEVKLGFGSILDEEVDNESF
GIDNVEVIFDNNDTTSNRRFGADSSLISEGHYLVASDPTDKNLEATIYNFRQRGPEWNPI
DVSVTPERLDTAKFGVSVDIDGKTAVVGAQDYDDTGAAFIYTKQDDQWTLKTTLQPQTLE
IGDKFGSSVAIRNNMVVVGAAQANNAYVFERLAVREESNSNQVKPAWRQTNLIEGGNVNS
FGAAVDVDTTRMVIGAPDSEKAFVFQKSLSNKGLNWNLEHTLDSNANDFGAAVTLDQETI
AVGAPAAGQVQVYDLDKIDSPDTLNIGGNSDRFGHAIDLSGDWLVVGAPGDNNDTGTAYT
FQRDNNQWQQYQGININSSNTGDFFGHDVAIDNDKIVIGAYGHDLDDKTDSGAAYAYGYK
GGKWGLETAQTPLGGEGAGLGDGDQLGYAVAISGSLAILGAPQLEGRPGNAIDTNGAGRI
YFRDVSEPRNIEITEVNRTVVEGDEANVLKGTLGDSDVEIPDFNFFDIGEVTVELGDAAD
RFTVEEPGFTAVGLQHFTVETNDGDDEINIKSDNVGTPSNGQFIYTGDNPENLQNGRITS
ELEAINGETQVKAGSNTTDRFNVEADADLELTKGKLTVNNQDEVKIAYAEDISLKGGDGD
NVIKASSWYQNGNVSLDGGNGSDQVEANLSEVPTRNLKDSGKEGNDQLLLFGNIVREIKG
NNRNYLSTVIPSDYKTKTNVKKFTTRNTLYEDFEGVFNGNNDNITGVDNAQTLALNNVND
DLLNGN
Download sequence
Identical sequences K9YWB8
gi|428780782|ref|YP_007172568.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]