SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9YXU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9YXU6
Domain Number 1 Region: 12-146
Classification Level Classification E-value
Superfamily CheY-like 8.97e-42
Family CheY-related 0.00037
Further Details:      
 
Domain Number 2 Region: 201-371
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.1e-41
Family Histidine kinase 0.00077
Further Details:      
 
Domain Number 3 Region: 136-208
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000392
Family Homodimeric domain of signal transducing histidine kinase 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9YXU6
Sequence length 374
Comment (tr|K9YXU6|K9YXU6_DACSA) Signal transduction histidine kinase {ECO:0000313|EMBL:AFZ50938.1} KW=Complete proteome OX=13035 OS=Dactylococcopsis salina PCC 8305. GN=Dacsa_2325 OC=Dactylococcopsis.
Sequence
MNHSLDTAKTKPDTILVVDDSPDNVLLVQSILEEDGYHIEVAEDGEGAIAQVEANPPQLI
LLDVMMPGMDGFEVTERIRQQKALPFIPILLITAYDQPSVVKGLDSGADDFIRKPVELEE
LLARVRSLLRLKHSVDERDEIARQRSDFVSRLTHDLRTPLVAADRMLSLFQQGALGELSP
PMAEAVATMSRSNRNLLDMVNTLLEVYRFEAGRKVLNFVTVDLKAVIDEVVQELNPLAEE
KGLDLKKQEEIEGNQTETKVEGDRLELRRVFTNLIGNAIKFTDEGSVKVSLKQVTETEPP
TLLITVEDTGPGVSPEDQNRLFERFRKGKHRNSGSGLGLHLSQRILESHNGSISLESEVG
KGSRFTVKLPVKVE
Download sequence
Identical sequences K9YXU6
WP_015229930.1.8022 gi|428780509|ref|YP_007172295.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]