SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9YY04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9YY04
Domain Number 1 Region: 1-79
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.24e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.0014
Further Details:      
 
Domain Number 2 Region: 82-181
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.51e-17
Family Glutathione S-transferase (GST), C-terminal domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9YY04
Sequence length 183
Comment (tr|K9YY04|K9YY04_DACSA) Glutathione S-transferase {ECO:0000313|EMBL:AFZ50998.1} KW=Complete proteome OX=13035 OS=Dactylococcopsis salina PCC 8305. GN=Dacsa_2391 OC=Dactylococcopsis.
Sequence
MIKLYGGKRSRASIVQWYLEELSIPYEFVVLDMENGEHKKPDFLAINPMGKVPAIDDNGF
YLWESGAILSYLSDQYDSEKRSIQERGKINQWILFANATLGPGIFIESNRETEKPKLFPP
LNEHLNQYNYLVNDTFTAADVAVGAYLAYMPMMLQLNFSDYSGIENYVKRLSDRPAFKTS
MSR
Download sequence
Identical sequences K9YY04
WP_015229989.1.8022 gi|428780569|ref|YP_007172355.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]