SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9YZ61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9YZ61
Domain Number 1 Region: 359-616
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.97e-76
Family Acylamino-acid-releasing enzyme, C-terminal donain 0.004
Further Details:      
 
Domain Number 2 Region: 29-361
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 3.73e-21
Family DPP6 N-terminal domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9YZ61
Sequence length 633
Comment (tr|K9YZ61|K9YZ61_DACSA) Dipeptidyl aminopeptidase/acylaminoacyl peptidase {ECO:0000313|EMBL:AFZ51418.1} KW=Complete proteome OX=13035 OS=Dactylococcopsis salina PCC 8305. GN=Dacsa_2858 OC=Dactylococcopsis.
Sequence
MTATTTPSTQTQLPPLIPRSLLFGNPKRARPRLSPDAKYLAYIAPDEKDVLQVWVRTIGQ
TDDRQVTADKKRGIRAYFWTYKPDQLIYLQDSDGDENFHLYAVDLEKNIVRDLTPFQGVK
AQLIDLDPETPDQVLVGLNLNNPQKFDVYRINLNNGAVEFDSDNPGNIVSWTADAQFTIR
AAVAATPDGGSDLLYRETPDQDWETLRHWSADDEGGALSFSKDGKTLYIVGSHEANAQRL
LSLNLDSREETVIAADDQYDVGDVLIHPTKRHIEAVSFYKDKEEWQVLDEAIAKDFEVLR
QLRDGEFGIASRDLADKNWLVAYLTDDGPVYYYHYHRDTQNAEFLFTNQPELEDLPLAKM
QPTSYQARDGLTIHGYLTTPVGVEAKQLPTVLYVHGGPWARDTWGYNPAVQWLANRGYAV
LQVNFRGSTGYGKDFLNAGNREWGAAMHDDLVDAVEWLKAQGISDPDRIAIMGGSYGGYA
TLAGLTFTPDVFACGVDIVGPSNLVTLINSVPPYWKPMMSMFAHRVGDIETEEEFLKARS
PLFFADRIKKPLLIGQGANDPRVKQAESEQIVAEMREKGKPVQYALYTDEGHGFARPENR
MHFYAIVENFLAEYLNGRAEEIGEIEGHSGIVS
Download sequence
Identical sequences K9YZ61
gi|428780989|ref|YP_007172775.1| WP_015230398.1.8022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]