SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9YZP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9YZP8
Domain Number 1 Region: 163-268
Classification Level Classification E-value
Superfamily KaiA/RbsU domain 5.89e-45
Family Circadian clock protein KaiA, C-terminal domain 0.000042
Further Details:      
 
Domain Number 2 Region: 13-123
Classification Level Classification E-value
Superfamily CheY-like 0.0000000000298
Family N-terminal domain of the circadian clock protein KaiA 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9YZP8
Sequence length 275
Comment (tr|K9YZP8|K9YZP8_DACSA) KaiA domain protein {ECO:0000313|EMBL:AFZ51962.1} KW=Complete proteome OX=13035 OS=Dactylococcopsis salina PCC 8305. GN=Dacsa_3474 OC=Dactylococcopsis.
Sequence
MSAQIFLGLFTVNDDLAQSLQKILSNNHYDLRVFNSSDALWESVWDQTEQIDCLILHQCE
GLEEMLTRLKQDGKLLPAVILTSANENQALVYHPAQKYLFLESLSDTSSAIDDAIRDFLQ
LTPDRKPQAEIEHINEFLTIKQHRLTEKLQERLGYKGVYYKRKPEDFFNNLSSEEKQELL
TELTEEYRLILLEYFSNATEVNSRIDQFVTRAFFANLSVSHIMEIHMNLIEQFSQHLKLE
GRSDEILLDYRLTLIDIVAHLCEMYRRSLPTKVTR
Download sequence
Identical sequences K9YZP8
gi|428781533|ref|YP_007173319.1| WP_015230936.1.8022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]