SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L0AKR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L0AKR6
Domain Number 1 Region: 37-143
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000156
Family Homeodomain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L0AKR6
Sequence length 181
Comment (tr|L0AKR6|L0AKR6_NATGS) Transposase {ECO:0000313|EMBL:AFZ74401.1} KW=Complete proteome; Reference proteome OX=797304 OS=CIP 104747 / JCM 8860 / NBRC 102187 / NCIMB 2189 / SP2). GN=Natgr_3273 OC=Natronobacterium.
Sequence
MATFENVSVEDLRQILAEVDDADATKRLMAAITYKEIEDLTQAEAAALYGFSSSWASKWF
NRLERLADEPFEEVVYDKPREGRPSELSDDEHEQFVEVLHESPEDVGYDAPAWSVSLARH
YLSEEFGVEYCERHVRRLMSEAGLSWKTARPEFHKSDERAQEAWEEGFKKSATTWTMNTR
S
Download sequence
Identical sequences L0AKR6
gi|429193172|ref|YP_007178850.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]