SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L0E0E7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L0E0E7
Domain Number 1 Region: 5-93
Classification Level Classification E-value
Superfamily YccV-like 1.44e-33
Family YccV-like 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L0E0E7
Sequence length 106
Comment (tr|L0E0E7|L0E0E7_THIND) Hemimethylated DNA binding protein {ECO:0000313|EMBL:AGA34685.1} KW=Complete proteome; Reference proteome OX=1255043 OS=ALEN2). GN=TVNIR_3048 OC=Ectothiorhodospiraceae; Thioalkalivibrio.
Sequence
MTAATRFSVGELVHHRKFGYRGVIVGVDPVFAGSDEWYEAVARSRPPRDQPWYHVLVDGD
THSTYVAERHLEADTSGVQIEHPDLGRYFDRFVNGRYGRGTGSRIH
Download sequence
Identical sequences L0E0E7
WP_015259793.1.12263 gi|430762309|ref|YP_007218166.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]